Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KBB9

Protein Details
Accession J3KBB9   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
187-209DLYATLPCRRRRNESRQHQDLSRHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 5, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
KEGG cim:CIMG_03426  -  
Amino Acid Sequences MTSTCHFTTAEPFALSFSLFAAVVSQWRVRMGSAFWRLFRVDSVAAAAAAVPDFFVGSAYSSINPRNKHPISAHTQGRLLSARKIGTDESGPKGRNTPFPKPRPPVKLPMPQPVLHSHLRSRINGDCAMKREIRLGKPDHSGGLFKSCPGPPAAGALHPPIYNHGDPSQTLNITIDVAPILQPDILDLYATLPCRRRRNESRQHQDLSRHHLSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.14
4 0.1
5 0.08
6 0.08
7 0.07
8 0.08
9 0.08
10 0.09
11 0.12
12 0.13
13 0.12
14 0.14
15 0.15
16 0.14
17 0.15
18 0.16
19 0.22
20 0.29
21 0.32
22 0.31
23 0.33
24 0.34
25 0.33
26 0.31
27 0.26
28 0.18
29 0.15
30 0.16
31 0.14
32 0.13
33 0.12
34 0.11
35 0.07
36 0.06
37 0.05
38 0.04
39 0.03
40 0.03
41 0.03
42 0.04
43 0.04
44 0.05
45 0.06
46 0.07
47 0.08
48 0.1
49 0.16
50 0.2
51 0.22
52 0.24
53 0.33
54 0.34
55 0.38
56 0.38
57 0.39
58 0.41
59 0.48
60 0.48
61 0.4
62 0.41
63 0.36
64 0.36
65 0.33
66 0.27
67 0.21
68 0.21
69 0.2
70 0.18
71 0.19
72 0.17
73 0.15
74 0.17
75 0.17
76 0.18
77 0.23
78 0.23
79 0.22
80 0.26
81 0.26
82 0.32
83 0.35
84 0.41
85 0.46
86 0.53
87 0.61
88 0.63
89 0.68
90 0.68
91 0.65
92 0.63
93 0.61
94 0.62
95 0.57
96 0.59
97 0.55
98 0.48
99 0.47
100 0.42
101 0.39
102 0.33
103 0.31
104 0.24
105 0.28
106 0.29
107 0.28
108 0.28
109 0.26
110 0.27
111 0.29
112 0.3
113 0.26
114 0.27
115 0.3
116 0.27
117 0.25
118 0.28
119 0.3
120 0.29
121 0.33
122 0.34
123 0.34
124 0.36
125 0.37
126 0.31
127 0.27
128 0.26
129 0.2
130 0.22
131 0.18
132 0.16
133 0.19
134 0.18
135 0.18
136 0.18
137 0.18
138 0.13
139 0.17
140 0.17
141 0.13
142 0.15
143 0.16
144 0.17
145 0.16
146 0.16
147 0.16
148 0.2
149 0.2
150 0.21
151 0.2
152 0.2
153 0.2
154 0.25
155 0.25
156 0.2
157 0.21
158 0.19
159 0.17
160 0.17
161 0.17
162 0.12
163 0.08
164 0.08
165 0.08
166 0.07
167 0.08
168 0.06
169 0.06
170 0.06
171 0.08
172 0.07
173 0.07
174 0.07
175 0.08
176 0.11
177 0.13
178 0.17
179 0.22
180 0.3
181 0.4
182 0.45
183 0.54
184 0.62
185 0.71
186 0.78
187 0.82
188 0.85
189 0.84
190 0.84
191 0.8
192 0.79
193 0.74
194 0.73
195 0.71