Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KHS3

Protein Details
Accession J3KHS3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
138-171SFVLKNQPRKGKKDKSTKKTRRERNKEKADNGENBasic
NLS Segment(s)
PositionSequence
144-165QPRKGKKDKSTKKTRRERNKEK
Subcellular Location(s) nucl 16, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016024  ARM-type_fold  
IPR045196  IF2/IF5  
IPR002735  Transl_init_fac_IF2/IF5_dom  
IPR016189  Transl_init_fac_IF2/IF5_N  
IPR016190  Transl_init_fac_IF2/IF5_Zn-bd  
IPR003307  W2_domain  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003743  F:translation initiation factor activity  
KEGG cim:CIMG_00797  -  
Pfam View protein in Pfam  
PF01873  eIF-5_eIF-2B  
PF02020  W2  
PROSITE View protein in PROSITE  
PS51363  W2  
CDD cd11561  W2_eIF5  
Amino Acid Sequences MATVNIRRDVSDPFYRYKMERLQAKIEGKGNGIKTVVVNLNSVAQALGRPPAYLIKYFGFELGAQANPKPTDDRWIINGAHDAGKLQDYLDGFISKFVLCKKCKNPETNVVIKDPRILLDCKACGERSEVDSRLKLSSFVLKNQPRKGKKDKSTKKTRRERNKEKADNGENGENGETNGSPGDSPSEGDENGDVAAEAHSDDEFTRRINAEAKEIEQDNEIDDDEWAVDVSEEAVKARAKELPDDLKRSLVFDDEDEGEGENGAASAYDQLGSWIVSEAEQSEKGVSGVSDVDIYMKAKELGIESKHKTLAVLAQTIFDEKIVKQIPSRAGMLKKMITSERHMKAFLGGTERFVGKERPELIPQISAILLGYYQEDLVSEDILKNWGSKASKKYVDLPTSKKVRKAAEKFLEWLETAESEDESDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.44
4 0.47
5 0.49
6 0.48
7 0.52
8 0.52
9 0.56
10 0.61
11 0.63
12 0.61
13 0.57
14 0.51
15 0.46
16 0.47
17 0.41
18 0.36
19 0.32
20 0.27
21 0.23
22 0.27
23 0.28
24 0.23
25 0.22
26 0.2
27 0.22
28 0.21
29 0.2
30 0.14
31 0.1
32 0.1
33 0.1
34 0.14
35 0.11
36 0.12
37 0.12
38 0.18
39 0.21
40 0.22
41 0.24
42 0.22
43 0.24
44 0.24
45 0.23
46 0.19
47 0.16
48 0.17
49 0.16
50 0.16
51 0.15
52 0.16
53 0.2
54 0.19
55 0.21
56 0.22
57 0.2
58 0.26
59 0.28
60 0.3
61 0.28
62 0.33
63 0.32
64 0.3
65 0.33
66 0.27
67 0.25
68 0.23
69 0.19
70 0.15
71 0.16
72 0.14
73 0.11
74 0.12
75 0.1
76 0.12
77 0.13
78 0.13
79 0.12
80 0.13
81 0.14
82 0.11
83 0.13
84 0.18
85 0.25
86 0.27
87 0.36
88 0.44
89 0.54
90 0.62
91 0.66
92 0.67
93 0.68
94 0.72
95 0.71
96 0.65
97 0.6
98 0.54
99 0.48
100 0.44
101 0.34
102 0.28
103 0.24
104 0.22
105 0.2
106 0.23
107 0.23
108 0.22
109 0.24
110 0.23
111 0.21
112 0.23
113 0.23
114 0.22
115 0.26
116 0.27
117 0.27
118 0.28
119 0.29
120 0.27
121 0.25
122 0.21
123 0.17
124 0.23
125 0.22
126 0.26
127 0.34
128 0.39
129 0.46
130 0.54
131 0.62
132 0.6
133 0.66
134 0.72
135 0.73
136 0.75
137 0.79
138 0.82
139 0.83
140 0.88
141 0.9
142 0.9
143 0.9
144 0.91
145 0.91
146 0.92
147 0.92
148 0.91
149 0.92
150 0.9
151 0.85
152 0.83
153 0.76
154 0.69
155 0.62
156 0.53
157 0.42
158 0.34
159 0.29
160 0.2
161 0.16
162 0.12
163 0.08
164 0.06
165 0.06
166 0.05
167 0.05
168 0.05
169 0.07
170 0.06
171 0.07
172 0.08
173 0.09
174 0.09
175 0.09
176 0.09
177 0.07
178 0.07
179 0.07
180 0.05
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.06
190 0.06
191 0.06
192 0.08
193 0.08
194 0.1
195 0.14
196 0.15
197 0.17
198 0.18
199 0.18
200 0.19
201 0.19
202 0.18
203 0.14
204 0.13
205 0.1
206 0.1
207 0.09
208 0.07
209 0.06
210 0.06
211 0.05
212 0.05
213 0.04
214 0.03
215 0.03
216 0.03
217 0.04
218 0.04
219 0.04
220 0.04
221 0.06
222 0.07
223 0.08
224 0.09
225 0.11
226 0.11
227 0.13
228 0.17
229 0.24
230 0.27
231 0.32
232 0.31
233 0.31
234 0.31
235 0.3
236 0.26
237 0.19
238 0.16
239 0.12
240 0.14
241 0.11
242 0.12
243 0.11
244 0.11
245 0.09
246 0.08
247 0.08
248 0.05
249 0.04
250 0.03
251 0.03
252 0.03
253 0.03
254 0.03
255 0.04
256 0.04
257 0.04
258 0.05
259 0.05
260 0.05
261 0.05
262 0.05
263 0.05
264 0.05
265 0.06
266 0.07
267 0.08
268 0.08
269 0.08
270 0.08
271 0.08
272 0.08
273 0.07
274 0.06
275 0.06
276 0.06
277 0.06
278 0.06
279 0.06
280 0.07
281 0.08
282 0.07
283 0.08
284 0.08
285 0.08
286 0.09
287 0.1
288 0.14
289 0.17
290 0.24
291 0.26
292 0.29
293 0.3
294 0.29
295 0.27
296 0.24
297 0.25
298 0.21
299 0.22
300 0.18
301 0.19
302 0.19
303 0.2
304 0.19
305 0.13
306 0.12
307 0.09
308 0.16
309 0.18
310 0.19
311 0.19
312 0.25
313 0.29
314 0.3
315 0.33
316 0.31
317 0.32
318 0.34
319 0.37
320 0.33
321 0.3
322 0.31
323 0.32
324 0.3
325 0.34
326 0.4
327 0.41
328 0.4
329 0.4
330 0.37
331 0.36
332 0.36
333 0.31
334 0.27
335 0.22
336 0.22
337 0.24
338 0.24
339 0.22
340 0.21
341 0.23
342 0.19
343 0.26
344 0.27
345 0.28
346 0.31
347 0.34
348 0.33
349 0.32
350 0.3
351 0.24
352 0.21
353 0.17
354 0.14
355 0.1
356 0.08
357 0.06
358 0.07
359 0.06
360 0.06
361 0.06
362 0.06
363 0.07
364 0.08
365 0.09
366 0.09
367 0.09
368 0.1
369 0.12
370 0.12
371 0.12
372 0.12
373 0.18
374 0.2
375 0.27
376 0.34
377 0.41
378 0.47
379 0.49
380 0.57
381 0.6
382 0.65
383 0.67
384 0.65
385 0.66
386 0.7
387 0.71
388 0.69
389 0.66
390 0.66
391 0.7
392 0.71
393 0.73
394 0.71
395 0.71
396 0.68
397 0.65
398 0.58
399 0.48
400 0.41
401 0.32
402 0.23
403 0.21
404 0.18
405 0.15
406 0.12