Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9CJH1

Protein Details
Accession W9CJH1   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKRNPRKLKWTKAFRKAAGKEBasic
NLS Segment(s)
PositionSequence
5-16PRKLKWTKAFRK
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKLKWTKAFRKAAGKEMVVDSTLNFSARRNVPVRYNREHIATTLKAMQRVAEVRARRERVFYKKRMEGNAARQREANRKLVAENEHLLPKMRGSEKKRLEELGEEVNELDLESQQRSVFGKQKIRLKELVDGGMEEDDDMEMDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.78
4 0.76
5 0.71
6 0.61
7 0.53
8 0.46
9 0.41
10 0.31
11 0.27
12 0.19
13 0.16
14 0.16
15 0.14
16 0.12
17 0.12
18 0.19
19 0.21
20 0.27
21 0.26
22 0.28
23 0.36
24 0.45
25 0.51
26 0.49
27 0.52
28 0.47
29 0.48
30 0.46
31 0.38
32 0.35
33 0.29
34 0.24
35 0.26
36 0.25
37 0.24
38 0.23
39 0.22
40 0.19
41 0.2
42 0.2
43 0.2
44 0.21
45 0.25
46 0.33
47 0.36
48 0.33
49 0.37
50 0.4
51 0.45
52 0.52
53 0.53
54 0.53
55 0.55
56 0.59
57 0.57
58 0.56
59 0.5
60 0.52
61 0.55
62 0.49
63 0.43
64 0.42
65 0.42
66 0.45
67 0.44
68 0.39
69 0.31
70 0.3
71 0.3
72 0.32
73 0.32
74 0.26
75 0.24
76 0.2
77 0.2
78 0.2
79 0.2
80 0.17
81 0.14
82 0.17
83 0.2
84 0.26
85 0.31
86 0.41
87 0.47
88 0.53
89 0.54
90 0.51
91 0.47
92 0.42
93 0.4
94 0.36
95 0.28
96 0.23
97 0.2
98 0.19
99 0.17
100 0.14
101 0.11
102 0.06
103 0.07
104 0.08
105 0.09
106 0.09
107 0.11
108 0.13
109 0.18
110 0.24
111 0.3
112 0.38
113 0.44
114 0.52
115 0.57
116 0.59
117 0.59
118 0.55
119 0.54
120 0.49
121 0.46
122 0.39
123 0.33
124 0.29
125 0.25
126 0.22
127 0.14
128 0.11
129 0.07