Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K8T5

Protein Details
Accession J3K8T5    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-40WTHITSTKKSSSRHRPPQPKDQLAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 5, cyto 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
KEGG cim:CIMG_06743  -  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MSQPARRRKVVDNDGWTHITSTKKSSSRHRPPQPKDQLAPAEIPDGLTFEKLKDKYDWHKQQWMESHSWTVLKGLLEQEIARVSGKIRNCVCFGLGSPSGFSRGGWVDRRSISMFQLAALELTVELLSQAKIINPDNLYAQDPVFNDMDKKLLKYAGFNVVQDPDAFALVAKETFLYAPGAEKSHLIDLLLRDPGLFFGSTFDDIHSATTEGDTCAQFVGRRRSLLLPEFEPNPSAFWRTTLYWNGEAHLPPSAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.64
3 0.56
4 0.47
5 0.41
6 0.36
7 0.3
8 0.31
9 0.35
10 0.39
11 0.44
12 0.53
13 0.6
14 0.66
15 0.75
16 0.8
17 0.83
18 0.84
19 0.9
20 0.9
21 0.87
22 0.79
23 0.76
24 0.7
25 0.62
26 0.56
27 0.46
28 0.37
29 0.28
30 0.26
31 0.18
32 0.14
33 0.12
34 0.12
35 0.11
36 0.1
37 0.18
38 0.18
39 0.21
40 0.23
41 0.29
42 0.36
43 0.47
44 0.55
45 0.53
46 0.6
47 0.59
48 0.62
49 0.63
50 0.59
51 0.52
52 0.44
53 0.4
54 0.34
55 0.33
56 0.27
57 0.2
58 0.18
59 0.14
60 0.14
61 0.12
62 0.12
63 0.12
64 0.12
65 0.12
66 0.1
67 0.11
68 0.09
69 0.09
70 0.09
71 0.13
72 0.14
73 0.21
74 0.22
75 0.24
76 0.25
77 0.25
78 0.25
79 0.21
80 0.2
81 0.18
82 0.18
83 0.15
84 0.14
85 0.14
86 0.16
87 0.15
88 0.14
89 0.11
90 0.11
91 0.15
92 0.19
93 0.2
94 0.21
95 0.22
96 0.24
97 0.24
98 0.23
99 0.2
100 0.18
101 0.17
102 0.14
103 0.14
104 0.11
105 0.09
106 0.07
107 0.06
108 0.04
109 0.04
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.04
118 0.07
119 0.08
120 0.11
121 0.11
122 0.11
123 0.12
124 0.13
125 0.14
126 0.13
127 0.12
128 0.12
129 0.11
130 0.13
131 0.13
132 0.12
133 0.11
134 0.11
135 0.14
136 0.12
137 0.13
138 0.11
139 0.14
140 0.14
141 0.15
142 0.18
143 0.21
144 0.22
145 0.21
146 0.21
147 0.2
148 0.2
149 0.18
150 0.16
151 0.09
152 0.08
153 0.07
154 0.06
155 0.05
156 0.05
157 0.05
158 0.05
159 0.04
160 0.05
161 0.05
162 0.06
163 0.06
164 0.06
165 0.08
166 0.09
167 0.1
168 0.1
169 0.11
170 0.12
171 0.12
172 0.13
173 0.11
174 0.12
175 0.12
176 0.14
177 0.15
178 0.13
179 0.11
180 0.11
181 0.12
182 0.11
183 0.1
184 0.07
185 0.08
186 0.11
187 0.12
188 0.13
189 0.12
190 0.12
191 0.12
192 0.13
193 0.12
194 0.11
195 0.09
196 0.1
197 0.1
198 0.1
199 0.12
200 0.12
201 0.11
202 0.1
203 0.12
204 0.14
205 0.2
206 0.29
207 0.3
208 0.31
209 0.34
210 0.37
211 0.42
212 0.45
213 0.43
214 0.37
215 0.38
216 0.39
217 0.36
218 0.34
219 0.29
220 0.25
221 0.22
222 0.22
223 0.19
224 0.19
225 0.22
226 0.23
227 0.29
228 0.33
229 0.36
230 0.37
231 0.37
232 0.37
233 0.37
234 0.35
235 0.31