Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9CE56

Protein Details
Accession W9CE56    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
81-124ITKIKEKRANKEERERYEKMAENMHQKRVDRLRRREKRNKMLKSBasic
NLS Segment(s)
PositionSequence
33-45WHPVKKAFRPRAG
51-53KRK
62-124TKAKEKDMKEEKEAARQAHITKIKEKRANKEERERYEKMAENMHQKRVDRLRRREKRNKMLKS
Subcellular Location(s) nucl 18, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTEMAPVTVATESTVPTLVVLPQGMRKNGKQWHPVKKAFRPRAGNTSYEKRKANDDAVAATKAKEKDMKEEKEAARQAHITKIKEKRANKEERERYEKMAENMHQKRVDRLRRREKRNKMLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.08
4 0.08
5 0.09
6 0.09
7 0.09
8 0.09
9 0.09
10 0.15
11 0.19
12 0.22
13 0.26
14 0.27
15 0.33
16 0.4
17 0.46
18 0.5
19 0.54
20 0.61
21 0.66
22 0.73
23 0.73
24 0.76
25 0.79
26 0.78
27 0.77
28 0.74
29 0.69
30 0.7
31 0.65
32 0.59
33 0.53
34 0.55
35 0.53
36 0.51
37 0.49
38 0.41
39 0.43
40 0.42
41 0.39
42 0.32
43 0.27
44 0.23
45 0.23
46 0.23
47 0.19
48 0.16
49 0.17
50 0.15
51 0.15
52 0.18
53 0.17
54 0.25
55 0.34
56 0.36
57 0.36
58 0.43
59 0.43
60 0.46
61 0.49
62 0.4
63 0.33
64 0.32
65 0.3
66 0.31
67 0.35
68 0.29
69 0.34
70 0.41
71 0.48
72 0.54
73 0.58
74 0.6
75 0.65
76 0.73
77 0.73
78 0.76
79 0.77
80 0.77
81 0.8
82 0.73
83 0.68
84 0.65
85 0.61
86 0.53
87 0.51
88 0.46
89 0.49
90 0.51
91 0.54
92 0.51
93 0.47
94 0.54
95 0.57
96 0.63
97 0.63
98 0.7
99 0.74
100 0.8
101 0.9
102 0.91
103 0.92
104 0.92