Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1RX06

Protein Details
Accession A0A0E1RX06    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
3-23LNIYKLFKTNRQKNNNYIFVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
KEGG cim:CIMG_13351  -  
Amino Acid Sequences MFLNIYKLFKTNRQKNNNYIFVKSFLTNLNDLVELDFVKDTGNGNKCTSQYSNIGTLNDSTLRLVDIKNINLTHIHNLTNKMSDVNEDNENNKNNGTDGDNRNNRDNKDDEKSSSYVLENTEHKKARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.77
3 0.83
4 0.83
5 0.75
6 0.68
7 0.6
8 0.53
9 0.49
10 0.4
11 0.32
12 0.26
13 0.26
14 0.22
15 0.21
16 0.19
17 0.16
18 0.16
19 0.15
20 0.12
21 0.09
22 0.09
23 0.08
24 0.07
25 0.06
26 0.07
27 0.08
28 0.14
29 0.18
30 0.2
31 0.22
32 0.24
33 0.24
34 0.28
35 0.28
36 0.24
37 0.23
38 0.22
39 0.25
40 0.24
41 0.23
42 0.2
43 0.19
44 0.17
45 0.15
46 0.13
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.1
53 0.11
54 0.12
55 0.15
56 0.15
57 0.15
58 0.16
59 0.17
60 0.16
61 0.16
62 0.17
63 0.17
64 0.2
65 0.2
66 0.2
67 0.19
68 0.17
69 0.15
70 0.15
71 0.15
72 0.15
73 0.18
74 0.18
75 0.2
76 0.24
77 0.26
78 0.25
79 0.23
80 0.2
81 0.17
82 0.17
83 0.19
84 0.22
85 0.27
86 0.36
87 0.42
88 0.45
89 0.52
90 0.56
91 0.54
92 0.51
93 0.49
94 0.46
95 0.47
96 0.48
97 0.45
98 0.45
99 0.45
100 0.41
101 0.38
102 0.33
103 0.27
104 0.25
105 0.25
106 0.26
107 0.29
108 0.37