Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9CCS9

Protein Details
Accession W9CCS9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-27VETRNQKIEKAPRRELKKARLHydrophilic
38-57EAEPRQRSKRQRVVRIHSEDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MTLILPVETRNQKIEKAPRRELKKARLIESSDGDSDIEAEPRQRSKRQRVVRIHSEDFQKEKSRGFPVSYKGKGYSNVTENSVPMPGSITMDISRKFTDIDERFAQRIKEQKEVTEWFTNLVVSIENKLDSQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.53
3 0.57
4 0.64
5 0.68
6 0.74
7 0.81
8 0.81
9 0.8
10 0.79
11 0.76
12 0.7
13 0.68
14 0.63
15 0.58
16 0.52
17 0.46
18 0.37
19 0.31
20 0.27
21 0.2
22 0.18
23 0.14
24 0.11
25 0.09
26 0.1
27 0.12
28 0.18
29 0.23
30 0.29
31 0.37
32 0.46
33 0.56
34 0.63
35 0.71
36 0.74
37 0.79
38 0.81
39 0.8
40 0.72
41 0.66
42 0.61
43 0.53
44 0.46
45 0.41
46 0.36
47 0.29
48 0.28
49 0.27
50 0.27
51 0.26
52 0.26
53 0.26
54 0.27
55 0.34
56 0.34
57 0.32
58 0.3
59 0.3
60 0.3
61 0.3
62 0.28
63 0.24
64 0.24
65 0.25
66 0.24
67 0.22
68 0.2
69 0.18
70 0.13
71 0.1
72 0.1
73 0.08
74 0.09
75 0.08
76 0.09
77 0.1
78 0.13
79 0.14
80 0.15
81 0.16
82 0.15
83 0.15
84 0.15
85 0.23
86 0.22
87 0.28
88 0.3
89 0.32
90 0.33
91 0.35
92 0.36
93 0.3
94 0.37
95 0.35
96 0.39
97 0.37
98 0.38
99 0.42
100 0.45
101 0.47
102 0.45
103 0.41
104 0.34
105 0.33
106 0.3
107 0.24
108 0.2
109 0.16
110 0.11
111 0.13
112 0.13
113 0.14