Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KIF2

Protein Details
Accession J3KIF2    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
32-54GDKDARGKKKNRLDKWRQRREVGBasic
NLS Segment(s)
PositionSequence
32-57GDKDARGKKKNRLDKWRQRREVGWGG
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8, cyto 2.5
Family & Domain DBs
KEGG cim:CIMG_12803  -  
Amino Acid Sequences MKGHNLHSPRAIRIAGDKVSGRVYSRRPGIDGDKDARGKKKNRLDKWRQRREVGWGGKKQISSWFGGDASMRATLTPHVVERNHEGLGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.28
3 0.28
4 0.26
5 0.24
6 0.26
7 0.26
8 0.23
9 0.23
10 0.26
11 0.29
12 0.33
13 0.32
14 0.31
15 0.33
16 0.37
17 0.37
18 0.38
19 0.34
20 0.35
21 0.38
22 0.4
23 0.42
24 0.43
25 0.43
26 0.48
27 0.54
28 0.59
29 0.64
30 0.72
31 0.77
32 0.81
33 0.87
34 0.88
35 0.84
36 0.77
37 0.69
38 0.66
39 0.65
40 0.63
41 0.6
42 0.52
43 0.52
44 0.51
45 0.5
46 0.43
47 0.4
48 0.33
49 0.27
50 0.24
51 0.22
52 0.19
53 0.2
54 0.19
55 0.13
56 0.13
57 0.11
58 0.1
59 0.08
60 0.09
61 0.1
62 0.12
63 0.13
64 0.14
65 0.18
66 0.19
67 0.23
68 0.28
69 0.31
70 0.28