Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9CU52

Protein Details
Accession W9CU52   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPRRKLSPSDRLRKFKLRQHNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MPRRKLSPSDRLRKFKLRQHNIAEVPGHQFIDYDAGKSALRIMLDFANVYSLSGKEIIYDNLIKILPKHANHTSTVYLGLVFEPRHTDYSAYNESRRGILERVVEEINKFQHLVEVHFVLHLHYLVFDQIRPASAIYGLNFQSWTFDILTDDVAHIEHDSAIDRLLKPQSYQCPLIFSKKPGILPGAGEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.81
4 0.8
5 0.79
6 0.78
7 0.8
8 0.72
9 0.69
10 0.61
11 0.52
12 0.46
13 0.39
14 0.32
15 0.22
16 0.2
17 0.15
18 0.2
19 0.18
20 0.15
21 0.13
22 0.14
23 0.14
24 0.14
25 0.16
26 0.11
27 0.11
28 0.1
29 0.11
30 0.11
31 0.12
32 0.12
33 0.1
34 0.1
35 0.1
36 0.1
37 0.09
38 0.08
39 0.08
40 0.09
41 0.09
42 0.08
43 0.09
44 0.1
45 0.12
46 0.12
47 0.11
48 0.13
49 0.13
50 0.12
51 0.11
52 0.16
53 0.19
54 0.19
55 0.25
56 0.27
57 0.29
58 0.31
59 0.33
60 0.28
61 0.23
62 0.23
63 0.17
64 0.13
65 0.11
66 0.1
67 0.09
68 0.07
69 0.07
70 0.09
71 0.1
72 0.12
73 0.12
74 0.13
75 0.12
76 0.17
77 0.23
78 0.22
79 0.22
80 0.22
81 0.22
82 0.22
83 0.21
84 0.17
85 0.13
86 0.14
87 0.15
88 0.14
89 0.16
90 0.16
91 0.15
92 0.14
93 0.15
94 0.13
95 0.11
96 0.11
97 0.08
98 0.11
99 0.11
100 0.12
101 0.12
102 0.12
103 0.12
104 0.12
105 0.12
106 0.09
107 0.09
108 0.08
109 0.06
110 0.05
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.08
117 0.08
118 0.09
119 0.09
120 0.08
121 0.09
122 0.1
123 0.1
124 0.13
125 0.13
126 0.13
127 0.13
128 0.13
129 0.13
130 0.13
131 0.14
132 0.1
133 0.1
134 0.1
135 0.11
136 0.12
137 0.1
138 0.1
139 0.08
140 0.08
141 0.08
142 0.07
143 0.07
144 0.06
145 0.06
146 0.08
147 0.07
148 0.09
149 0.12
150 0.12
151 0.16
152 0.2
153 0.21
154 0.22
155 0.29
156 0.36
157 0.39
158 0.43
159 0.39
160 0.41
161 0.43
162 0.49
163 0.46
164 0.42
165 0.45
166 0.45
167 0.46
168 0.43
169 0.43
170 0.36
171 0.33