Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9CIF8

Protein Details
Accession W9CIF8    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-24VGSWKKEGERREKRMKSEREMBasic
78-110GEELGKEEERKRKRKRKWKRKRKFCGGGEREEGBasic
NLS Segment(s)
PositionSequence
8-22KKEGERREKRMKSER
84-111EEERKRKRKRKWKRKRKFCGGGEREEGR
Subcellular Location(s) nucl 14, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MLKVGSWKKEGERREKRMKSEREMERGTGRGGEEGMGVGDGNRNRNGIGIGIGIGIGIGIGIGWVGAEDEELGWVKAGEELGKEEERKRKRKRKWKRKRKFCGGGEREEGRRGLGGRGVGDVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.8
4 0.83
5 0.82
6 0.79
7 0.79
8 0.77
9 0.74
10 0.7
11 0.64
12 0.58
13 0.51
14 0.43
15 0.35
16 0.28
17 0.2
18 0.17
19 0.14
20 0.1
21 0.09
22 0.08
23 0.06
24 0.05
25 0.04
26 0.08
27 0.09
28 0.11
29 0.12
30 0.13
31 0.12
32 0.13
33 0.13
34 0.1
35 0.09
36 0.07
37 0.06
38 0.06
39 0.05
40 0.04
41 0.04
42 0.03
43 0.02
44 0.02
45 0.01
46 0.01
47 0.01
48 0.01
49 0.01
50 0.01
51 0.01
52 0.01
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.07
68 0.1
69 0.13
70 0.14
71 0.19
72 0.28
73 0.37
74 0.47
75 0.56
76 0.64
77 0.73
78 0.82
79 0.89
80 0.91
81 0.94
82 0.95
83 0.95
84 0.96
85 0.97
86 0.97
87 0.96
88 0.93
89 0.93
90 0.87
91 0.83
92 0.79
93 0.73
94 0.64
95 0.57
96 0.48
97 0.37
98 0.35
99 0.28
100 0.23
101 0.22
102 0.21
103 0.19