Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9CL75

Protein Details
Accession W9CL75    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-46VKSAKMVKKRASNGRNKKGRGBasic
111-146GKIVRVRSRVGRRNRAPPPRVRYNKDGKKVNPNQAAHydrophilic
NLS Segment(s)
PositionSequence
29-49AKMVKKRASNGRNKKGRGHVK
115-140RVRSRVGRRNRAPPPRVRYNKDGKKV
Subcellular Location(s) nucl 17, cyto_nucl 12, mito 5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MFDIRISINDNRQPINQRFESLANSVKSAKMVKKRASNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISEASVFSEYTVPKMYLKLQYCVSCAIHGKIVRVRSRVGRRNRAPPPRVRYNKDGKKVNPNQAAAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.44
4 0.42
5 0.41
6 0.41
7 0.39
8 0.34
9 0.35
10 0.27
11 0.28
12 0.26
13 0.24
14 0.25
15 0.27
16 0.3
17 0.33
18 0.41
19 0.46
20 0.54
21 0.61
22 0.69
23 0.74
24 0.78
25 0.79
26 0.82
27 0.83
28 0.78
29 0.77
30 0.76
31 0.77
32 0.73
33 0.72
34 0.7
35 0.7
36 0.76
37 0.78
38 0.74
39 0.66
40 0.65
41 0.62
42 0.63
43 0.61
44 0.59
45 0.56
46 0.58
47 0.6
48 0.62
49 0.65
50 0.64
51 0.66
52 0.67
53 0.69
54 0.65
55 0.66
56 0.6
57 0.61
58 0.53
59 0.45
60 0.4
61 0.32
62 0.3
63 0.23
64 0.21
65 0.12
66 0.12
67 0.09
68 0.08
69 0.08
70 0.07
71 0.07
72 0.05
73 0.05
74 0.06
75 0.06
76 0.06
77 0.09
78 0.09
79 0.1
80 0.11
81 0.11
82 0.11
83 0.12
84 0.15
85 0.2
86 0.23
87 0.24
88 0.27
89 0.28
90 0.28
91 0.3
92 0.27
93 0.22
94 0.22
95 0.21
96 0.22
97 0.22
98 0.24
99 0.25
100 0.31
101 0.34
102 0.34
103 0.36
104 0.4
105 0.5
106 0.55
107 0.61
108 0.65
109 0.67
110 0.75
111 0.82
112 0.83
113 0.8
114 0.81
115 0.8
116 0.8
117 0.83
118 0.79
119 0.78
120 0.79
121 0.81
122 0.81
123 0.82
124 0.77
125 0.79
126 0.81
127 0.83
128 0.8
129 0.74