Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9CFZ5

Protein Details
Accession W9CFZ5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-42PSPLPGQQPQNQNPRRKRKKTHPIKPRHRLIRTPNLHHydrophilic
NLS Segment(s)
PositionSequence
19-44PRRKRKKTHPIKPRHRLIRTPNLHKA
Subcellular Location(s) mito 16, nucl 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MLSPSPSPLPGQQPQNQNPRRKRKKTHPIKPRHRLIRTPNLHKAGRGHHAITLTIRTLFRIGIGIGPGILASKHILFLLAHKGFAVVDAAREYVLVGTGEAFEPVGAREITDGAGGVGRGGVGGVGGGGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.67
3 0.7
4 0.73
5 0.77
6 0.8
7 0.85
8 0.85
9 0.88
10 0.88
11 0.92
12 0.93
13 0.93
14 0.92
15 0.92
16 0.93
17 0.93
18 0.92
19 0.91
20 0.86
21 0.84
22 0.82
23 0.81
24 0.79
25 0.77
26 0.75
27 0.71
28 0.65
29 0.59
30 0.54
31 0.48
32 0.44
33 0.39
34 0.31
35 0.27
36 0.27
37 0.26
38 0.23
39 0.19
40 0.14
41 0.13
42 0.12
43 0.11
44 0.11
45 0.1
46 0.09
47 0.08
48 0.07
49 0.06
50 0.06
51 0.06
52 0.05
53 0.05
54 0.04
55 0.04
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.07
65 0.15
66 0.15
67 0.15
68 0.14
69 0.15
70 0.14
71 0.14
72 0.14
73 0.05
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.05
81 0.06
82 0.05
83 0.04
84 0.05
85 0.05
86 0.06
87 0.06
88 0.06
89 0.05
90 0.05
91 0.05
92 0.08
93 0.07
94 0.07
95 0.07
96 0.08
97 0.09
98 0.08
99 0.08
100 0.06
101 0.07
102 0.07
103 0.06
104 0.05
105 0.05
106 0.04
107 0.04
108 0.04
109 0.03
110 0.03
111 0.02