Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K6U3

Protein Details
Accession J3K6U3   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-41AETPRSPPRELRRKRRLVDYSLHydrophilic
NLS Segment(s)
PositionSequence
31-33RRK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
KEGG cim:CIMG_05812  -  
Amino Acid Sequences MASTEAEPRSVIVIDDDTDAETPRSPPRELRRKRRLVDYSLPEYEALFDGPALLNSSASTTSQPPKKRKIPNLKVVLATANQEIHTIFEAESAKIGDLQEEVRRLKKSNTELEIKHRAELIRKNEKICKLEAESGKPSCAGTGSAQGASLLTQRPVDHVVEISLAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.12
5 0.12
6 0.13
7 0.12
8 0.12
9 0.13
10 0.19
11 0.22
12 0.23
13 0.31
14 0.4
15 0.51
16 0.6
17 0.68
18 0.73
19 0.79
20 0.82
21 0.84
22 0.8
23 0.77
24 0.76
25 0.73
26 0.68
27 0.6
28 0.56
29 0.45
30 0.38
31 0.31
32 0.22
33 0.15
34 0.08
35 0.06
36 0.06
37 0.06
38 0.07
39 0.08
40 0.07
41 0.07
42 0.07
43 0.08
44 0.08
45 0.08
46 0.1
47 0.11
48 0.17
49 0.23
50 0.31
51 0.37
52 0.45
53 0.54
54 0.61
55 0.69
56 0.74
57 0.77
58 0.79
59 0.8
60 0.73
61 0.65
62 0.56
63 0.47
64 0.36
65 0.28
66 0.19
67 0.12
68 0.1
69 0.09
70 0.09
71 0.08
72 0.08
73 0.07
74 0.06
75 0.08
76 0.09
77 0.09
78 0.09
79 0.09
80 0.08
81 0.09
82 0.09
83 0.06
84 0.06
85 0.08
86 0.1
87 0.13
88 0.15
89 0.18
90 0.19
91 0.21
92 0.24
93 0.29
94 0.33
95 0.37
96 0.4
97 0.43
98 0.43
99 0.49
100 0.55
101 0.49
102 0.43
103 0.38
104 0.35
105 0.35
106 0.4
107 0.42
108 0.43
109 0.45
110 0.49
111 0.53
112 0.58
113 0.55
114 0.49
115 0.46
116 0.4
117 0.45
118 0.45
119 0.44
120 0.44
121 0.43
122 0.41
123 0.36
124 0.31
125 0.24
126 0.2
127 0.16
128 0.12
129 0.17
130 0.18
131 0.18
132 0.18
133 0.17
134 0.17
135 0.15
136 0.16
137 0.12
138 0.12
139 0.14
140 0.14
141 0.17
142 0.2
143 0.2
144 0.19
145 0.18
146 0.17