Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JVA3

Protein Details
Accession A0A0D8JVA3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
204-226ITYKRTPLDPAPKGKRRKMEKKKBasic
NLS Segment(s)
PositionSequence
214-226APKGKRRKMEKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
KEGG cim:CIMG_12054  -  
Amino Acid Sequences MPVTSKPTLAPLDTSKSLVFPSELHDSPLFSAKFEMIKHEDALKTPITPPTAYTDLLKTLTPMIATPLSASAPSTSKSFSSSSSNPSTSTSPYFCTCQTHQKSLTTPLLTPLSATTTRSQPDRVQKPPRTPRTPRTPINLRSLRGSESAKASPVTESPRSASARSLLSPVAGSHAESNVRYLDASRCSSCARPVIVRQVVTRTITYKRTPLDPAPKGKRRKMEKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.27
4 0.26
5 0.23
6 0.2
7 0.13
8 0.17
9 0.21
10 0.21
11 0.24
12 0.24
13 0.24
14 0.24
15 0.31
16 0.26
17 0.2
18 0.21
19 0.19
20 0.21
21 0.21
22 0.25
23 0.22
24 0.24
25 0.25
26 0.29
27 0.28
28 0.26
29 0.29
30 0.24
31 0.21
32 0.21
33 0.23
34 0.21
35 0.2
36 0.2
37 0.23
38 0.25
39 0.24
40 0.24
41 0.21
42 0.21
43 0.22
44 0.2
45 0.15
46 0.13
47 0.13
48 0.12
49 0.1
50 0.11
51 0.1
52 0.1
53 0.1
54 0.1
55 0.09
56 0.09
57 0.1
58 0.08
59 0.09
60 0.1
61 0.11
62 0.11
63 0.11
64 0.14
65 0.14
66 0.15
67 0.2
68 0.21
69 0.25
70 0.29
71 0.29
72 0.27
73 0.29
74 0.28
75 0.24
76 0.25
77 0.2
78 0.19
79 0.19
80 0.2
81 0.19
82 0.22
83 0.22
84 0.29
85 0.32
86 0.35
87 0.36
88 0.37
89 0.38
90 0.38
91 0.41
92 0.31
93 0.27
94 0.25
95 0.24
96 0.21
97 0.19
98 0.14
99 0.13
100 0.12
101 0.13
102 0.12
103 0.14
104 0.15
105 0.16
106 0.19
107 0.2
108 0.3
109 0.35
110 0.41
111 0.49
112 0.53
113 0.62
114 0.7
115 0.75
116 0.74
117 0.74
118 0.74
119 0.74
120 0.77
121 0.71
122 0.69
123 0.68
124 0.65
125 0.68
126 0.64
127 0.55
128 0.5
129 0.47
130 0.41
131 0.35
132 0.32
133 0.24
134 0.23
135 0.23
136 0.21
137 0.2
138 0.18
139 0.16
140 0.17
141 0.21
142 0.19
143 0.19
144 0.2
145 0.25
146 0.26
147 0.26
148 0.25
149 0.22
150 0.22
151 0.22
152 0.22
153 0.16
154 0.15
155 0.15
156 0.13
157 0.13
158 0.11
159 0.11
160 0.1
161 0.12
162 0.14
163 0.13
164 0.15
165 0.12
166 0.13
167 0.12
168 0.13
169 0.15
170 0.18
171 0.22
172 0.22
173 0.23
174 0.26
175 0.28
176 0.3
177 0.3
178 0.29
179 0.3
180 0.34
181 0.42
182 0.44
183 0.44
184 0.42
185 0.43
186 0.43
187 0.4
188 0.37
189 0.31
190 0.32
191 0.35
192 0.37
193 0.38
194 0.37
195 0.39
196 0.43
197 0.49
198 0.54
199 0.56
200 0.63
201 0.68
202 0.73
203 0.78
204 0.8
205 0.81
206 0.82