Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9CE93

Protein Details
Accession W9CE93    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-65DANAWQCRRRKLRRTKAPSDPHPPHydrophilic
NLS Segment(s)
PositionSequence
50-58RRKLRRTKA
Subcellular Location(s) mito 14.5, mito_nucl 13, nucl 10.5
Family & Domain DBs
Amino Acid Sequences MSSWLIGLWTKYHMTPNIYLLRSRINAKVVRPTSDELDTKLDANAWQCRRRKLRRTKAPSDPHPPERIRLPWFRANTTKIQMKGPNEVWSNEYAHLPRAVCHIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.32
4 0.36
5 0.36
6 0.35
7 0.32
8 0.34
9 0.32
10 0.33
11 0.3
12 0.29
13 0.31
14 0.32
15 0.41
16 0.37
17 0.38
18 0.38
19 0.37
20 0.34
21 0.35
22 0.33
23 0.25
24 0.27
25 0.24
26 0.21
27 0.19
28 0.16
29 0.13
30 0.15
31 0.2
32 0.22
33 0.28
34 0.31
35 0.39
36 0.48
37 0.56
38 0.64
39 0.68
40 0.74
41 0.79
42 0.84
43 0.84
44 0.85
45 0.85
46 0.81
47 0.8
48 0.75
49 0.69
50 0.67
51 0.6
52 0.52
53 0.48
54 0.46
55 0.42
56 0.41
57 0.42
58 0.42
59 0.44
60 0.46
61 0.47
62 0.46
63 0.46
64 0.46
65 0.46
66 0.41
67 0.44
68 0.45
69 0.43
70 0.46
71 0.44
72 0.44
73 0.41
74 0.4
75 0.36
76 0.33
77 0.33
78 0.26
79 0.28
80 0.21
81 0.22
82 0.24
83 0.23
84 0.21