Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9CDS6

Protein Details
Accession W9CDS6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
167-193LIVHCKKEGAPQPKKKSKKAGKEGEELBasic
NLS Segment(s)
PositionSequence
175-188GAPQPKKKSKKAGK
Subcellular Location(s) nucl 13.5, cyto_nucl 12.833, cyto 11, cyto_mito 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MSADTATQPINTTTVAQDADPLPLTKVDSAVQGLSSSPTEEKTSKHRRTSSSAPGVWNINDLEKDGKELEIAKETQKLNWRINKSPMTLDDPEKGFLKKPLTTPPVKKIDLHFPLGLEVTARNMKGVTIKDALDAIYKQYRKKADDELGEPVLAGFEWDKDESWTRLIVHCKKEGAPQPKKKSKKAGKEGEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.16
5 0.15
6 0.17
7 0.17
8 0.17
9 0.15
10 0.15
11 0.17
12 0.14
13 0.15
14 0.13
15 0.14
16 0.14
17 0.14
18 0.13
19 0.12
20 0.11
21 0.12
22 0.11
23 0.11
24 0.1
25 0.12
26 0.15
27 0.16
28 0.19
29 0.27
30 0.38
31 0.44
32 0.52
33 0.57
34 0.57
35 0.64
36 0.69
37 0.69
38 0.67
39 0.61
40 0.54
41 0.5
42 0.47
43 0.4
44 0.34
45 0.24
46 0.17
47 0.14
48 0.14
49 0.14
50 0.12
51 0.14
52 0.12
53 0.12
54 0.11
55 0.12
56 0.12
57 0.13
58 0.14
59 0.14
60 0.19
61 0.19
62 0.21
63 0.28
64 0.32
65 0.35
66 0.41
67 0.45
68 0.43
69 0.5
70 0.5
71 0.44
72 0.41
73 0.37
74 0.36
75 0.33
76 0.31
77 0.28
78 0.25
79 0.24
80 0.23
81 0.21
82 0.17
83 0.18
84 0.19
85 0.18
86 0.19
87 0.26
88 0.3
89 0.35
90 0.38
91 0.43
92 0.46
93 0.45
94 0.45
95 0.4
96 0.44
97 0.42
98 0.41
99 0.33
100 0.26
101 0.26
102 0.24
103 0.21
104 0.12
105 0.09
106 0.08
107 0.1
108 0.1
109 0.09
110 0.09
111 0.09
112 0.13
113 0.14
114 0.15
115 0.15
116 0.16
117 0.16
118 0.16
119 0.16
120 0.14
121 0.13
122 0.13
123 0.18
124 0.21
125 0.22
126 0.28
127 0.33
128 0.34
129 0.38
130 0.42
131 0.42
132 0.45
133 0.46
134 0.45
135 0.4
136 0.37
137 0.33
138 0.25
139 0.18
140 0.12
141 0.1
142 0.05
143 0.05
144 0.08
145 0.09
146 0.09
147 0.12
148 0.16
149 0.17
150 0.19
151 0.2
152 0.19
153 0.24
154 0.33
155 0.38
156 0.39
157 0.42
158 0.44
159 0.43
160 0.51
161 0.55
162 0.56
163 0.6
164 0.65
165 0.72
166 0.79
167 0.86
168 0.86
169 0.88
170 0.88
171 0.88
172 0.88
173 0.88