Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KKJ5

Protein Details
Accession J3KKJ5   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
115-136VGNLRRRAKRRFGWNRLQQIQPHydrophilic
NLS Segment(s)
PositionSequence
119-125RRRAKRR
Subcellular Location(s) mito 21, nucl 3, extr 2, cyto_nucl 2
Family & Domain DBs
KEGG cim:CIMG_02058  -  
Amino Acid Sequences MAVVLRKSPRPWMIMREILEYFCNADPQGSARDYYVGPEELYAKEALSMNYRLPEEFRNGLYLRLNLRCKDLGGAGNTNSPRYELEGPKGGLCDRRLGTSILHLRIVGSRFTRGVGNLRRRAKRRFGWNRLQQIQPVMRSTSLHTGLTHVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.48
4 0.44
5 0.4
6 0.37
7 0.3
8 0.25
9 0.18
10 0.18
11 0.13
12 0.12
13 0.12
14 0.13
15 0.17
16 0.15
17 0.15
18 0.14
19 0.16
20 0.15
21 0.17
22 0.17
23 0.14
24 0.13
25 0.13
26 0.14
27 0.13
28 0.14
29 0.13
30 0.1
31 0.11
32 0.12
33 0.12
34 0.13
35 0.14
36 0.13
37 0.16
38 0.16
39 0.15
40 0.16
41 0.17
42 0.18
43 0.18
44 0.18
45 0.19
46 0.19
47 0.21
48 0.2
49 0.21
50 0.2
51 0.24
52 0.27
53 0.23
54 0.26
55 0.25
56 0.23
57 0.22
58 0.2
59 0.17
60 0.16
61 0.16
62 0.14
63 0.17
64 0.17
65 0.17
66 0.15
67 0.13
68 0.11
69 0.14
70 0.18
71 0.16
72 0.18
73 0.22
74 0.23
75 0.23
76 0.23
77 0.2
78 0.19
79 0.19
80 0.21
81 0.17
82 0.19
83 0.2
84 0.2
85 0.19
86 0.23
87 0.28
88 0.24
89 0.24
90 0.22
91 0.21
92 0.23
93 0.24
94 0.2
95 0.15
96 0.16
97 0.16
98 0.17
99 0.18
100 0.16
101 0.24
102 0.3
103 0.38
104 0.45
105 0.53
106 0.61
107 0.66
108 0.72
109 0.73
110 0.72
111 0.74
112 0.77
113 0.77
114 0.8
115 0.83
116 0.86
117 0.82
118 0.76
119 0.68
120 0.65
121 0.61
122 0.53
123 0.46
124 0.39
125 0.34
126 0.33
127 0.34
128 0.34
129 0.31
130 0.29
131 0.26
132 0.28