Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9Y5B9

Protein Details
Accession W9Y5B9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTTAKRRAKEVKPKTKTFTGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
Amino Acid Sequences MTTAKRRAKEVKPKTKTFTGYFARSLHVLSVLHSPHLILTQTTNLIDAGHAEDERSNATPHVHNAVAAGELV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.74
4 0.65
5 0.63
6 0.58
7 0.53
8 0.5
9 0.44
10 0.38
11 0.33
12 0.3
13 0.21
14 0.17
15 0.13
16 0.11
17 0.14
18 0.13
19 0.13
20 0.12
21 0.12
22 0.1
23 0.11
24 0.09
25 0.05
26 0.06
27 0.07
28 0.08
29 0.08
30 0.08
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.08
37 0.08
38 0.08
39 0.08
40 0.09
41 0.11
42 0.12
43 0.11
44 0.11
45 0.15
46 0.17
47 0.19
48 0.23
49 0.21
50 0.2
51 0.19
52 0.19