Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XEG6

Protein Details
Accession W9XEG6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-65SNDSNKVKVKANKRAKKEEKEDMKSQHydrophilic
NLS Segment(s)
PositionSequence
45-57KVKVKANKRAKKE
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MVQTRSHGKPGARDIGKGGDSSATGQKIPQKRSHSKTEASNDSNKVKVKANKRAKKEEKEDMKSQSTQSKPDSLAKSTIATLIEKYGSLPLSDSAVDEPLSPKPETMLALLLNAMFSSARISHELAAKTLTTTIKAGYHKINVLKKTSWDERTRVLTEGGYTRYREKTATALGDLVEFLEENYQGDLNNLLPGPATDSSPSEIRKRLKEIKGLGDVGVDIFCDAAQAVWPCLAPFVDPRSAKTAEAIGIPSDAQALWESEEVNKDPMKMARLAAGLTTVRLEKKETEFKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.44
4 0.37
5 0.3
6 0.21
7 0.2
8 0.22
9 0.24
10 0.19
11 0.18
12 0.21
13 0.28
14 0.35
15 0.4
16 0.45
17 0.5
18 0.58
19 0.64
20 0.72
21 0.71
22 0.68
23 0.71
24 0.72
25 0.71
26 0.66
27 0.67
28 0.62
29 0.59
30 0.58
31 0.52
32 0.46
33 0.45
34 0.48
35 0.51
36 0.57
37 0.64
38 0.68
39 0.73
40 0.81
41 0.83
42 0.85
43 0.83
44 0.83
45 0.82
46 0.81
47 0.79
48 0.74
49 0.69
50 0.61
51 0.56
52 0.54
53 0.46
54 0.44
55 0.41
56 0.4
57 0.38
58 0.43
59 0.44
60 0.38
61 0.38
62 0.34
63 0.32
64 0.28
65 0.27
66 0.2
67 0.17
68 0.15
69 0.13
70 0.12
71 0.11
72 0.11
73 0.11
74 0.11
75 0.1
76 0.1
77 0.09
78 0.1
79 0.1
80 0.1
81 0.08
82 0.09
83 0.09
84 0.09
85 0.1
86 0.11
87 0.14
88 0.14
89 0.13
90 0.13
91 0.14
92 0.14
93 0.14
94 0.13
95 0.09
96 0.1
97 0.1
98 0.09
99 0.07
100 0.06
101 0.05
102 0.03
103 0.03
104 0.05
105 0.05
106 0.07
107 0.08
108 0.09
109 0.11
110 0.16
111 0.16
112 0.15
113 0.15
114 0.14
115 0.13
116 0.14
117 0.12
118 0.09
119 0.09
120 0.1
121 0.13
122 0.14
123 0.16
124 0.16
125 0.17
126 0.19
127 0.25
128 0.28
129 0.26
130 0.29
131 0.27
132 0.27
133 0.31
134 0.34
135 0.35
136 0.34
137 0.33
138 0.34
139 0.38
140 0.37
141 0.33
142 0.28
143 0.22
144 0.2
145 0.2
146 0.19
147 0.16
148 0.16
149 0.18
150 0.19
151 0.2
152 0.19
153 0.18
154 0.17
155 0.19
156 0.19
157 0.16
158 0.15
159 0.14
160 0.14
161 0.12
162 0.09
163 0.06
164 0.04
165 0.04
166 0.04
167 0.04
168 0.05
169 0.05
170 0.05
171 0.05
172 0.06
173 0.06
174 0.06
175 0.07
176 0.07
177 0.06
178 0.06
179 0.06
180 0.09
181 0.09
182 0.1
183 0.09
184 0.1
185 0.13
186 0.16
187 0.19
188 0.19
189 0.25
190 0.29
191 0.33
192 0.4
193 0.48
194 0.5
195 0.55
196 0.56
197 0.56
198 0.56
199 0.52
200 0.44
201 0.35
202 0.3
203 0.22
204 0.18
205 0.11
206 0.05
207 0.04
208 0.04
209 0.04
210 0.04
211 0.03
212 0.06
213 0.07
214 0.08
215 0.09
216 0.09
217 0.09
218 0.1
219 0.1
220 0.08
221 0.11
222 0.15
223 0.22
224 0.23
225 0.26
226 0.31
227 0.32
228 0.31
229 0.29
230 0.27
231 0.2
232 0.21
233 0.19
234 0.14
235 0.13
236 0.13
237 0.11
238 0.1
239 0.08
240 0.08
241 0.08
242 0.08
243 0.09
244 0.1
245 0.11
246 0.12
247 0.16
248 0.17
249 0.19
250 0.19
251 0.19
252 0.22
253 0.24
254 0.26
255 0.25
256 0.24
257 0.25
258 0.25
259 0.24
260 0.21
261 0.21
262 0.18
263 0.16
264 0.18
265 0.16
266 0.18
267 0.19
268 0.22
269 0.23
270 0.31