Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XM80

Protein Details
Accession W9XM80   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
92-117ASSQSGDKPKRKPPKLGPKKSTTTPSHydrophilic
NLS Segment(s)
PositionSequence
27-35KAKPEWKVR
99-111KPKRKPPKLGPKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPNVSFDIFFDKDFINVTATRGYKAPKAKPEWKVRTLPKLAPKPQPEDPSTPRPLPRDKLVHSRQPPAHQKQLEPAPASEKGENKVEEISSASSQSGDKPKRKPPKLGPKKSTTTPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.14
3 0.14
4 0.15
5 0.19
6 0.2
7 0.2
8 0.21
9 0.22
10 0.25
11 0.33
12 0.38
13 0.41
14 0.49
15 0.56
16 0.64
17 0.72
18 0.74
19 0.72
20 0.74
21 0.71
22 0.72
23 0.68
24 0.64
25 0.63
26 0.64
27 0.64
28 0.64
29 0.62
30 0.59
31 0.6
32 0.6
33 0.54
34 0.51
35 0.51
36 0.5
37 0.5
38 0.47
39 0.44
40 0.43
41 0.44
42 0.4
43 0.41
44 0.39
45 0.38
46 0.45
47 0.47
48 0.51
49 0.5
50 0.54
51 0.5
52 0.53
53 0.59
54 0.55
55 0.58
56 0.51
57 0.49
58 0.48
59 0.51
60 0.47
61 0.39
62 0.34
63 0.29
64 0.3
65 0.32
66 0.28
67 0.24
68 0.23
69 0.26
70 0.26
71 0.23
72 0.22
73 0.19
74 0.17
75 0.17
76 0.17
77 0.13
78 0.14
79 0.13
80 0.12
81 0.12
82 0.17
83 0.25
84 0.31
85 0.37
86 0.43
87 0.54
88 0.64
89 0.71
90 0.76
91 0.77
92 0.8
93 0.85
94 0.89
95 0.87
96 0.85
97 0.86
98 0.83