Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XE81

Protein Details
Accession W9XE81   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
140-167HDGMKRILRLRWRKCPRNDTRKAPAEAGHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 12, mito 6, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024311  Lipocalin-like  
Pfam View protein in Pfam  
PF13924  Lipocalin_5  
Amino Acid Sequences MASFYSRLLGTWELLSFTAANIDNREDVTYPMGSACKGQIMYSEDGYMAAVLQWGYVEPYKTDWIRATTEEFADAGRRTMAYSGPFYLDEQSRDSQEILHHAKISIPPNWVDTVQLRQAEMTEEHGETILTLGPKFPMEHDGMKRILRLRWRKCPRNDTRKAPAEAGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.12
4 0.1
5 0.13
6 0.13
7 0.14
8 0.15
9 0.16
10 0.16
11 0.17
12 0.19
13 0.15
14 0.14
15 0.16
16 0.14
17 0.13
18 0.13
19 0.13
20 0.12
21 0.12
22 0.11
23 0.11
24 0.11
25 0.11
26 0.14
27 0.18
28 0.2
29 0.2
30 0.2
31 0.16
32 0.16
33 0.16
34 0.12
35 0.07
36 0.05
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.05
43 0.07
44 0.07
45 0.07
46 0.09
47 0.14
48 0.14
49 0.16
50 0.16
51 0.18
52 0.19
53 0.2
54 0.21
55 0.18
56 0.18
57 0.17
58 0.15
59 0.12
60 0.13
61 0.12
62 0.09
63 0.07
64 0.07
65 0.07
66 0.08
67 0.09
68 0.08
69 0.09
70 0.1
71 0.1
72 0.11
73 0.11
74 0.13
75 0.12
76 0.12
77 0.13
78 0.14
79 0.14
80 0.14
81 0.14
82 0.13
83 0.13
84 0.18
85 0.18
86 0.19
87 0.18
88 0.17
89 0.19
90 0.22
91 0.25
92 0.21
93 0.19
94 0.19
95 0.2
96 0.21
97 0.2
98 0.17
99 0.16
100 0.17
101 0.2
102 0.2
103 0.18
104 0.17
105 0.17
106 0.18
107 0.16
108 0.17
109 0.15
110 0.14
111 0.14
112 0.14
113 0.13
114 0.11
115 0.11
116 0.09
117 0.07
118 0.07
119 0.08
120 0.08
121 0.1
122 0.1
123 0.11
124 0.13
125 0.16
126 0.23
127 0.26
128 0.3
129 0.33
130 0.34
131 0.36
132 0.36
133 0.36
134 0.4
135 0.47
136 0.52
137 0.6
138 0.69
139 0.76
140 0.82
141 0.88
142 0.89
143 0.9
144 0.91
145 0.89
146 0.89
147 0.88
148 0.82