Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KJ42

Protein Details
Accession J3KJ42    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
77-99DERSTSVYKNKNKNKKDFDKEVAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
KEGG cim:CIMG_12790  -  
Amino Acid Sequences MKITSKVPSLKLRSRTRAPDCFGPSLLERPGEFADQVKSTIWMWFKILQEQESDVDSAHRSKTQGVLAKYTEVNYSDERSTSVYKNKNKNKKDFDKEVALMPFSSTSCGGRQCKRDVEQALAPLAETKHDLGIVWDDMSGWRGWKFGPKRRILDGVPGLRGELACRSSEQGFRASGDLHHTGSREIIPEDSARRERYGFPQSWHHLVSEQTGVSGTPIPDNFPLYFLPSRRWLSNKTTRTSIQAETWPGPSKSWSLTMNVLLITDWDLAPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.79
3 0.78
4 0.78
5 0.76
6 0.75
7 0.71
8 0.66
9 0.58
10 0.51
11 0.45
12 0.4
13 0.37
14 0.3
15 0.24
16 0.24
17 0.25
18 0.23
19 0.21
20 0.19
21 0.2
22 0.19
23 0.2
24 0.17
25 0.17
26 0.16
27 0.2
28 0.19
29 0.17
30 0.19
31 0.23
32 0.24
33 0.29
34 0.31
35 0.27
36 0.27
37 0.28
38 0.26
39 0.22
40 0.21
41 0.15
42 0.14
43 0.15
44 0.15
45 0.15
46 0.15
47 0.15
48 0.16
49 0.2
50 0.24
51 0.29
52 0.29
53 0.31
54 0.3
55 0.32
56 0.31
57 0.28
58 0.24
59 0.19
60 0.2
61 0.18
62 0.2
63 0.18
64 0.17
65 0.17
66 0.18
67 0.2
68 0.21
69 0.28
70 0.33
71 0.41
72 0.51
73 0.6
74 0.68
75 0.73
76 0.79
77 0.81
78 0.83
79 0.83
80 0.81
81 0.76
82 0.72
83 0.65
84 0.59
85 0.49
86 0.39
87 0.3
88 0.23
89 0.19
90 0.12
91 0.12
92 0.09
93 0.09
94 0.1
95 0.16
96 0.21
97 0.25
98 0.3
99 0.33
100 0.38
101 0.39
102 0.44
103 0.39
104 0.39
105 0.35
106 0.32
107 0.29
108 0.23
109 0.2
110 0.14
111 0.13
112 0.09
113 0.08
114 0.07
115 0.06
116 0.07
117 0.07
118 0.06
119 0.07
120 0.07
121 0.06
122 0.06
123 0.06
124 0.06
125 0.07
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.14
132 0.21
133 0.29
134 0.37
135 0.43
136 0.46
137 0.49
138 0.53
139 0.46
140 0.47
141 0.45
142 0.38
143 0.33
144 0.3
145 0.27
146 0.22
147 0.21
148 0.14
149 0.1
150 0.09
151 0.09
152 0.09
153 0.11
154 0.13
155 0.16
156 0.17
157 0.17
158 0.16
159 0.16
160 0.17
161 0.15
162 0.14
163 0.16
164 0.17
165 0.15
166 0.16
167 0.16
168 0.15
169 0.16
170 0.16
171 0.13
172 0.11
173 0.11
174 0.11
175 0.13
176 0.15
177 0.19
178 0.23
179 0.23
180 0.24
181 0.26
182 0.27
183 0.32
184 0.38
185 0.35
186 0.34
187 0.41
188 0.44
189 0.45
190 0.43
191 0.37
192 0.3
193 0.28
194 0.28
195 0.22
196 0.18
197 0.14
198 0.13
199 0.12
200 0.12
201 0.13
202 0.11
203 0.12
204 0.12
205 0.15
206 0.16
207 0.19
208 0.18
209 0.17
210 0.17
211 0.19
212 0.23
213 0.22
214 0.25
215 0.3
216 0.33
217 0.36
218 0.4
219 0.4
220 0.45
221 0.55
222 0.58
223 0.55
224 0.57
225 0.55
226 0.56
227 0.55
228 0.49
229 0.43
230 0.41
231 0.42
232 0.38
233 0.41
234 0.41
235 0.37
236 0.35
237 0.32
238 0.3
239 0.28
240 0.3
241 0.28
242 0.25
243 0.28
244 0.29
245 0.28
246 0.25
247 0.22
248 0.17
249 0.16
250 0.15
251 0.13