Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XTW5

Protein Details
Accession W9XTW5    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
421-444NFDPQAKRRAHKAQRRAHRRGYELBasic
NLS Segment(s)
PositionSequence
66-67RK
427-440KRRAHKAQRRAHRR
Subcellular Location(s) cyto_nucl 7, nucl 6.5, cyto 6.5, mito 5, extr 5, pero 2
Family & Domain DBs
Amino Acid Sequences MPILQKVVKGIGSGIGLASEAIADHKDRKATQTQAVSPRPSGGEGSASTSRTAARHDVYPEEKRGRKGERERGLDGKHDSDSDSSSVSTSDLDNDRAEWALDEAAQQFEQPPPSYRETEASSSSPNGPASAEEFATAFLRTHKVATATVASKTYQPLPCPVILPQRRPKDKSRGFVRAYAPLLGSCADIDQQTFIDFLNDLDRASRASPVFNVINVACFAVGFVPSPIAMGVSIAVQAASRTAQEVQTRYRRNTYLDQINETLFKPRGLYCMIMTFKPDSPYEPVIGMDVRSTSTDAALAKATSNPDSELRQKLKSMRLTSGTSKGEMSLPESAPLVYPALDAALSEGTELSEPKQTGLRASAGFVANYLDRRAQASHAGMYPDGKLAAAAPGEKKFASRFSDPNHPANSGTILGLLSGGNFDPQAKRRAHKAQRRAHRRGYELSETDLKNAEMGRLPRRRQGVVRRVLQQDVLYLTIVNLPSESEMREMLQELERARK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.09
4 0.09
5 0.08
6 0.05
7 0.04
8 0.05
9 0.07
10 0.09
11 0.13
12 0.17
13 0.22
14 0.24
15 0.3
16 0.37
17 0.41
18 0.46
19 0.51
20 0.55
21 0.6
22 0.65
23 0.63
24 0.56
25 0.53
26 0.47
27 0.4
28 0.34
29 0.25
30 0.23
31 0.2
32 0.25
33 0.25
34 0.25
35 0.24
36 0.23
37 0.24
38 0.21
39 0.24
40 0.23
41 0.22
42 0.26
43 0.28
44 0.34
45 0.39
46 0.44
47 0.49
48 0.52
49 0.54
50 0.55
51 0.6
52 0.61
53 0.65
54 0.69
55 0.71
56 0.72
57 0.73
58 0.73
59 0.72
60 0.67
61 0.63
62 0.56
63 0.49
64 0.41
65 0.35
66 0.31
67 0.26
68 0.25
69 0.2
70 0.18
71 0.15
72 0.13
73 0.13
74 0.12
75 0.11
76 0.09
77 0.13
78 0.14
79 0.16
80 0.16
81 0.16
82 0.17
83 0.16
84 0.16
85 0.11
86 0.1
87 0.09
88 0.09
89 0.09
90 0.09
91 0.11
92 0.1
93 0.1
94 0.1
95 0.12
96 0.16
97 0.16
98 0.19
99 0.22
100 0.27
101 0.29
102 0.3
103 0.31
104 0.31
105 0.33
106 0.32
107 0.29
108 0.27
109 0.27
110 0.27
111 0.25
112 0.21
113 0.19
114 0.16
115 0.15
116 0.15
117 0.14
118 0.13
119 0.1
120 0.1
121 0.11
122 0.11
123 0.11
124 0.09
125 0.09
126 0.11
127 0.12
128 0.12
129 0.13
130 0.14
131 0.14
132 0.16
133 0.18
134 0.18
135 0.19
136 0.19
137 0.18
138 0.18
139 0.2
140 0.24
141 0.22
142 0.22
143 0.25
144 0.26
145 0.27
146 0.26
147 0.28
148 0.31
149 0.34
150 0.41
151 0.46
152 0.53
153 0.6
154 0.63
155 0.68
156 0.69
157 0.71
158 0.72
159 0.71
160 0.7
161 0.66
162 0.68
163 0.62
164 0.57
165 0.51
166 0.43
167 0.34
168 0.25
169 0.23
170 0.17
171 0.14
172 0.08
173 0.07
174 0.06
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.06
182 0.06
183 0.06
184 0.06
185 0.08
186 0.08
187 0.07
188 0.08
189 0.08
190 0.08
191 0.09
192 0.12
193 0.1
194 0.11
195 0.11
196 0.15
197 0.15
198 0.14
199 0.15
200 0.11
201 0.12
202 0.11
203 0.11
204 0.07
205 0.06
206 0.06
207 0.05
208 0.05
209 0.04
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.04
226 0.04
227 0.04
228 0.05
229 0.06
230 0.08
231 0.11
232 0.13
233 0.19
234 0.27
235 0.31
236 0.32
237 0.35
238 0.34
239 0.35
240 0.38
241 0.39
242 0.38
243 0.36
244 0.36
245 0.33
246 0.32
247 0.3
248 0.25
249 0.23
250 0.16
251 0.15
252 0.13
253 0.13
254 0.14
255 0.14
256 0.15
257 0.12
258 0.17
259 0.18
260 0.17
261 0.18
262 0.18
263 0.18
264 0.2
265 0.2
266 0.15
267 0.19
268 0.2
269 0.19
270 0.17
271 0.16
272 0.14
273 0.14
274 0.12
275 0.08
276 0.07
277 0.07
278 0.07
279 0.07
280 0.06
281 0.06
282 0.08
283 0.08
284 0.08
285 0.08
286 0.08
287 0.08
288 0.1
289 0.11
290 0.1
291 0.11
292 0.11
293 0.13
294 0.16
295 0.2
296 0.26
297 0.28
298 0.28
299 0.31
300 0.35
301 0.4
302 0.44
303 0.43
304 0.39
305 0.4
306 0.42
307 0.43
308 0.45
309 0.38
310 0.32
311 0.29
312 0.26
313 0.23
314 0.2
315 0.19
316 0.16
317 0.15
318 0.15
319 0.15
320 0.14
321 0.13
322 0.13
323 0.11
324 0.07
325 0.06
326 0.06
327 0.05
328 0.05
329 0.05
330 0.05
331 0.05
332 0.05
333 0.05
334 0.05
335 0.05
336 0.05
337 0.06
338 0.07
339 0.11
340 0.11
341 0.12
342 0.15
343 0.15
344 0.17
345 0.19
346 0.2
347 0.16
348 0.17
349 0.2
350 0.18
351 0.17
352 0.16
353 0.15
354 0.13
355 0.14
356 0.15
357 0.12
358 0.12
359 0.14
360 0.15
361 0.15
362 0.18
363 0.19
364 0.2
365 0.21
366 0.22
367 0.2
368 0.2
369 0.19
370 0.15
371 0.13
372 0.1
373 0.08
374 0.07
375 0.09
376 0.09
377 0.1
378 0.12
379 0.14
380 0.16
381 0.16
382 0.17
383 0.17
384 0.22
385 0.25
386 0.27
387 0.31
388 0.35
389 0.46
390 0.49
391 0.53
392 0.51
393 0.46
394 0.42
395 0.38
396 0.35
397 0.25
398 0.21
399 0.15
400 0.12
401 0.1
402 0.1
403 0.08
404 0.06
405 0.06
406 0.06
407 0.06
408 0.06
409 0.08
410 0.14
411 0.18
412 0.25
413 0.29
414 0.32
415 0.4
416 0.51
417 0.6
418 0.64
419 0.71
420 0.74
421 0.8
422 0.88
423 0.88
424 0.87
425 0.84
426 0.8
427 0.77
428 0.75
429 0.72
430 0.63
431 0.6
432 0.57
433 0.5
434 0.46
435 0.4
436 0.32
437 0.26
438 0.24
439 0.22
440 0.2
441 0.24
442 0.32
443 0.4
444 0.43
445 0.48
446 0.53
447 0.56
448 0.6
449 0.66
450 0.66
451 0.66
452 0.7
453 0.71
454 0.7
455 0.66
456 0.6
457 0.49
458 0.42
459 0.35
460 0.29
461 0.21
462 0.17
463 0.16
464 0.17
465 0.17
466 0.14
467 0.11
468 0.11
469 0.13
470 0.14
471 0.15
472 0.13
473 0.13
474 0.14
475 0.16
476 0.16
477 0.17
478 0.2
479 0.22