Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9ZIU1

Protein Details
Accession W9ZIU1   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-119RQELRRLEAEKKKNKKNQNKNDGQTTHydrophilic
NLS Segment(s)
PositionSequence
104-109KKKNKK
Subcellular Location(s) mito_nucl 9.166, nucl 9, mito 9, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029003  CENP-S/Mhf1  
IPR009072  Histone-fold  
Gene Ontology GO:0071821  C:FANCM-MHF complex  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF15630  CENP-S  
Amino Acid Sequences MASTTDVEAEALQKKLRSALWFQIGKIVDEESINLGVNATPQFIGSLMELVWAQIGNAAIDLEAFAKHAGRNTIKPDDVMLLTRRNEGLEQILRQELRRLEAEKKKNKKNQNKNDGQTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.24
4 0.24
5 0.26
6 0.31
7 0.38
8 0.38
9 0.38
10 0.41
11 0.38
12 0.35
13 0.31
14 0.24
15 0.16
16 0.14
17 0.15
18 0.1
19 0.1
20 0.09
21 0.08
22 0.08
23 0.07
24 0.08
25 0.08
26 0.07
27 0.06
28 0.06
29 0.06
30 0.06
31 0.07
32 0.06
33 0.06
34 0.05
35 0.06
36 0.05
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.03
50 0.03
51 0.04
52 0.04
53 0.04
54 0.05
55 0.07
56 0.11
57 0.13
58 0.16
59 0.21
60 0.25
61 0.25
62 0.25
63 0.24
64 0.22
65 0.2
66 0.2
67 0.17
68 0.18
69 0.19
70 0.2
71 0.19
72 0.18
73 0.18
74 0.16
75 0.2
76 0.19
77 0.19
78 0.2
79 0.24
80 0.23
81 0.24
82 0.28
83 0.23
84 0.23
85 0.26
86 0.27
87 0.33
88 0.42
89 0.52
90 0.58
91 0.66
92 0.73
93 0.79
94 0.86
95 0.88
96 0.9
97 0.91
98 0.91
99 0.92