Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XMH3

Protein Details
Accession W9XMH3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
59-88TSKPHNLRTKKPPTRPPPQQQQRPRKPSVSHydrophilic
NLS Segment(s)
PositionSequence
67-75TKKPPTRPP
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034078  NFX1_fam  
IPR019786  Zinc_finger_PHD-type_CS  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
CDD cd16492  RING-CH-C4HC3_NFX1-like  
Amino Acid Sequences PPRRGQPHPPSVSDSTNPVRTAGGRSFGGQLTRLHAEAPAFIPASVSPGRPSSPPQTPTSKPHNLRTKKPPTRPPPQQQQRPRKPSVSRSTAPDIATRIHEDILHNLYECAICTNEVGRNSKIWSCRTCWTVFHIGCIKRWSKNEGSAVQRPATQDDNETPVGKQWRCPGCNLPKDTAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.45
3 0.44
4 0.41
5 0.35
6 0.32
7 0.28
8 0.32
9 0.28
10 0.26
11 0.22
12 0.23
13 0.25
14 0.25
15 0.25
16 0.22
17 0.2
18 0.2
19 0.22
20 0.2
21 0.18
22 0.18
23 0.16
24 0.16
25 0.16
26 0.14
27 0.12
28 0.12
29 0.12
30 0.1
31 0.14
32 0.14
33 0.13
34 0.13
35 0.14
36 0.15
37 0.16
38 0.21
39 0.23
40 0.29
41 0.32
42 0.34
43 0.39
44 0.42
45 0.47
46 0.51
47 0.54
48 0.52
49 0.57
50 0.64
51 0.63
52 0.67
53 0.71
54 0.74
55 0.74
56 0.78
57 0.79
58 0.76
59 0.81
60 0.83
61 0.81
62 0.81
63 0.82
64 0.83
65 0.83
66 0.87
67 0.87
68 0.85
69 0.8
70 0.76
71 0.71
72 0.71
73 0.69
74 0.65
75 0.56
76 0.53
77 0.53
78 0.49
79 0.45
80 0.36
81 0.29
82 0.23
83 0.22
84 0.19
85 0.15
86 0.12
87 0.13
88 0.12
89 0.13
90 0.14
91 0.13
92 0.11
93 0.1
94 0.11
95 0.1
96 0.09
97 0.08
98 0.06
99 0.06
100 0.06
101 0.08
102 0.11
103 0.14
104 0.18
105 0.17
106 0.18
107 0.21
108 0.24
109 0.27
110 0.29
111 0.29
112 0.29
113 0.33
114 0.35
115 0.35
116 0.33
117 0.34
118 0.39
119 0.36
120 0.37
121 0.4
122 0.38
123 0.39
124 0.44
125 0.41
126 0.37
127 0.4
128 0.42
129 0.39
130 0.45
131 0.49
132 0.49
133 0.53
134 0.54
135 0.55
136 0.5
137 0.47
138 0.41
139 0.38
140 0.35
141 0.29
142 0.26
143 0.25
144 0.29
145 0.29
146 0.28
147 0.25
148 0.27
149 0.35
150 0.32
151 0.33
152 0.38
153 0.45
154 0.46
155 0.51
156 0.55
157 0.57
158 0.65
159 0.66