Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9Y6D1

Protein Details
Accession W9Y6D1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-67RAQIYKQRPPRGRRDARRRRARSPAGNEBasic
NLS Segment(s)
PositionSequence
45-62KQRPPRGRRDARRRRARS
Subcellular Location(s) plas 9, mito 4, E.R. 4, extr 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYISPVELVIAFANCMVWLVALYFLRRAFQEQRHLRAEARAQIYKQRPPRGRRDARRRRARSPAGNETAIVATSLEWEDLMTRFGRGQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.06
4 0.04
5 0.04
6 0.05
7 0.07
8 0.08
9 0.09
10 0.11
11 0.11
12 0.12
13 0.12
14 0.17
15 0.2
16 0.25
17 0.35
18 0.38
19 0.44
20 0.46
21 0.47
22 0.43
23 0.41
24 0.39
25 0.34
26 0.33
27 0.29
28 0.26
29 0.32
30 0.36
31 0.39
32 0.42
33 0.45
34 0.49
35 0.52
36 0.62
37 0.66
38 0.72
39 0.76
40 0.81
41 0.83
42 0.86
43 0.92
44 0.88
45 0.84
46 0.84
47 0.83
48 0.81
49 0.79
50 0.77
51 0.71
52 0.65
53 0.58
54 0.49
55 0.4
56 0.3
57 0.22
58 0.12
59 0.07
60 0.08
61 0.09
62 0.07
63 0.06
64 0.06
65 0.08
66 0.08
67 0.1
68 0.09
69 0.1