Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9YLE2

Protein Details
Accession W9YLE2    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
154-174ANLKGSKKRGHQQRRRPEGNLBasic
NLS Segment(s)
PositionSequence
159-169SKKRGHQQRRR
Subcellular Location(s) cyto 9.5, cyto_nucl 9, nucl 5.5, mito 5, pero 3, plas 1, extr 1, golg 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
Amino Acid Sequences MASRKLHTLLGAPLQDADEETFLLFSQDIPSNNLGFIDSRAETLEIEVAGHDYVLRQSPGLLNSNRGGGTTGAVLWKITPLLATWLASLPPLLCDVGVLGTNATVVELGCGLAGLMGLVLSRVVRCYVLTDQDYVMKFLKENISNHLPSPDSDANLKGSKKRGHQQRRRPEGNLKLIPLDWETDDVGVLRAAIAPEESIDLLLLCDCVYNEFLISPLVQTCVDICRLGSSSGKTTVLLVAQQLRSESTCELFLSTLLRHFDVWRVPDEKISAGLRSCSGYVVHLATLKQLDGGVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.2
4 0.17
5 0.11
6 0.1
7 0.1
8 0.09
9 0.08
10 0.09
11 0.08
12 0.07
13 0.1
14 0.14
15 0.15
16 0.18
17 0.21
18 0.2
19 0.21
20 0.2
21 0.17
22 0.14
23 0.14
24 0.15
25 0.13
26 0.13
27 0.14
28 0.14
29 0.14
30 0.14
31 0.14
32 0.09
33 0.09
34 0.08
35 0.08
36 0.07
37 0.07
38 0.06
39 0.05
40 0.07
41 0.1
42 0.1
43 0.09
44 0.1
45 0.13
46 0.17
47 0.23
48 0.22
49 0.23
50 0.24
51 0.26
52 0.25
53 0.22
54 0.2
55 0.14
56 0.14
57 0.11
58 0.11
59 0.09
60 0.09
61 0.09
62 0.07
63 0.08
64 0.07
65 0.06
66 0.06
67 0.05
68 0.09
69 0.1
70 0.1
71 0.1
72 0.11
73 0.11
74 0.11
75 0.11
76 0.07
77 0.07
78 0.07
79 0.06
80 0.05
81 0.05
82 0.06
83 0.06
84 0.06
85 0.06
86 0.05
87 0.04
88 0.05
89 0.05
90 0.04
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.03
109 0.03
110 0.04
111 0.05
112 0.05
113 0.08
114 0.09
115 0.13
116 0.14
117 0.15
118 0.15
119 0.19
120 0.19
121 0.18
122 0.17
123 0.13
124 0.12
125 0.14
126 0.18
127 0.18
128 0.18
129 0.22
130 0.26
131 0.26
132 0.26
133 0.26
134 0.21
135 0.17
136 0.24
137 0.2
138 0.16
139 0.16
140 0.17
141 0.18
142 0.21
143 0.22
144 0.18
145 0.23
146 0.27
147 0.32
148 0.39
149 0.47
150 0.55
151 0.64
152 0.72
153 0.76
154 0.82
155 0.81
156 0.77
157 0.75
158 0.72
159 0.71
160 0.63
161 0.53
162 0.44
163 0.4
164 0.36
165 0.29
166 0.21
167 0.12
168 0.11
169 0.1
170 0.09
171 0.09
172 0.08
173 0.07
174 0.06
175 0.05
176 0.04
177 0.05
178 0.05
179 0.05
180 0.04
181 0.04
182 0.04
183 0.05
184 0.05
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.03
192 0.04
193 0.04
194 0.05
195 0.06
196 0.06
197 0.06
198 0.06
199 0.06
200 0.07
201 0.07
202 0.06
203 0.06
204 0.08
205 0.07
206 0.08
207 0.08
208 0.09
209 0.11
210 0.1
211 0.1
212 0.11
213 0.12
214 0.14
215 0.16
216 0.16
217 0.18
218 0.21
219 0.22
220 0.2
221 0.19
222 0.19
223 0.17
224 0.15
225 0.14
226 0.17
227 0.17
228 0.18
229 0.17
230 0.17
231 0.17
232 0.19
233 0.18
234 0.14
235 0.14
236 0.14
237 0.14
238 0.13
239 0.13
240 0.13
241 0.13
242 0.16
243 0.16
244 0.17
245 0.17
246 0.18
247 0.22
248 0.25
249 0.26
250 0.28
251 0.28
252 0.28
253 0.3
254 0.31
255 0.28
256 0.27
257 0.26
258 0.24
259 0.23
260 0.24
261 0.22
262 0.22
263 0.21
264 0.18
265 0.17
266 0.15
267 0.16
268 0.16
269 0.17
270 0.17
271 0.17
272 0.19
273 0.2
274 0.18
275 0.16
276 0.15