Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9Y0M1

Protein Details
Accession W9Y0M1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
176-196AIDLEKKRKDKIRARKVGQLWHydrophilic
NLS Segment(s)
PositionSequence
181-191KKRKDKIRARK
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 5.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
Amino Acid Sequences MENLTLNDAPPPSSPQRQPNQSNAVLPGVPQQQGPPQLPPQMFTTAAQLLDLTDKKLLLVLRDGRKIFGILRSWDQFANLVLTDTRERYLVSIPAGTSPDAISATASKDAPSLSANTSLSTSTLPRNLYCDIPRGTYLVRGENVLLLGEVDLDKDDDPPPGYELGDVEEVFRLQHAIDLEKKRKDKIRARKVGQLWGGELEGSGEVLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.55
4 0.63
5 0.67
6 0.69
7 0.7
8 0.65
9 0.61
10 0.54
11 0.47
12 0.37
13 0.32
14 0.3
15 0.25
16 0.23
17 0.21
18 0.2
19 0.23
20 0.28
21 0.3
22 0.28
23 0.29
24 0.35
25 0.35
26 0.35
27 0.33
28 0.3
29 0.29
30 0.25
31 0.25
32 0.2
33 0.2
34 0.18
35 0.15
36 0.12
37 0.15
38 0.15
39 0.13
40 0.12
41 0.12
42 0.11
43 0.14
44 0.14
45 0.11
46 0.17
47 0.23
48 0.28
49 0.33
50 0.34
51 0.32
52 0.32
53 0.32
54 0.27
55 0.24
56 0.22
57 0.19
58 0.23
59 0.24
60 0.25
61 0.24
62 0.23
63 0.19
64 0.16
65 0.14
66 0.1
67 0.09
68 0.07
69 0.09
70 0.1
71 0.1
72 0.1
73 0.09
74 0.09
75 0.1
76 0.11
77 0.11
78 0.1
79 0.1
80 0.1
81 0.11
82 0.12
83 0.11
84 0.09
85 0.08
86 0.08
87 0.07
88 0.07
89 0.06
90 0.06
91 0.06
92 0.07
93 0.08
94 0.07
95 0.07
96 0.07
97 0.08
98 0.08
99 0.08
100 0.08
101 0.11
102 0.11
103 0.11
104 0.12
105 0.11
106 0.11
107 0.1
108 0.11
109 0.1
110 0.13
111 0.14
112 0.13
113 0.16
114 0.17
115 0.2
116 0.2
117 0.23
118 0.21
119 0.22
120 0.22
121 0.21
122 0.2
123 0.21
124 0.21
125 0.19
126 0.18
127 0.17
128 0.16
129 0.15
130 0.15
131 0.11
132 0.09
133 0.06
134 0.05
135 0.05
136 0.05
137 0.04
138 0.04
139 0.05
140 0.05
141 0.07
142 0.08
143 0.09
144 0.11
145 0.12
146 0.13
147 0.13
148 0.13
149 0.12
150 0.11
151 0.12
152 0.13
153 0.12
154 0.11
155 0.11
156 0.11
157 0.1
158 0.1
159 0.08
160 0.06
161 0.08
162 0.09
163 0.12
164 0.2
165 0.3
166 0.37
167 0.45
168 0.49
169 0.54
170 0.61
171 0.68
172 0.7
173 0.72
174 0.76
175 0.79
176 0.81
177 0.83
178 0.79
179 0.78
180 0.72
181 0.63
182 0.54
183 0.45
184 0.4
185 0.3
186 0.25
187 0.17
188 0.12