Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9YQQ1

Protein Details
Accession W9YQQ1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-42QRKLTARTRKAERKADQERARKRKAEKKMRKAARKRSLSYYBasic
NLS Segment(s)
PositionSequence
7-37ARTRKAERKADQERARKRKAEKKMRKAARKR
Subcellular Location(s) nucl 14, mito 7, cyto 6
Family & Domain DBs
Amino Acid Sequences MQRKLTARTRKAERKADQERARKRKAEKKMRKAARKRSLSYYGGGLAWGFDPNAGMLHSGRDHAIAADGASQPVSNAGSGLDASDLKPVRGHTWGIHYGKTGMHVQVHDQDFHGSRECSGKVGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.84
4 0.82
5 0.82
6 0.84
7 0.84
8 0.84
9 0.8
10 0.8
11 0.79
12 0.8
13 0.82
14 0.82
15 0.83
16 0.86
17 0.89
18 0.91
19 0.92
20 0.92
21 0.91
22 0.88
23 0.81
24 0.78
25 0.75
26 0.66
27 0.57
28 0.48
29 0.38
30 0.3
31 0.25
32 0.17
33 0.1
34 0.09
35 0.08
36 0.06
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.05
60 0.06
61 0.06
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.11
72 0.11
73 0.11
74 0.13
75 0.14
76 0.15
77 0.17
78 0.19
79 0.15
80 0.22
81 0.3
82 0.3
83 0.3
84 0.28
85 0.27
86 0.26
87 0.28
88 0.24
89 0.18
90 0.19
91 0.19
92 0.21
93 0.27
94 0.29
95 0.27
96 0.25
97 0.27
98 0.26
99 0.28
100 0.29
101 0.22
102 0.22
103 0.26
104 0.26