Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JXE0

Protein Details
Accession A0A0D8JXE0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-94QETLKNYLKKRQNYKKTNKSTYRKKDKYKQDLEVAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
Gene Ontology GO:0006338  P:chromatin remodeling  
KEGG cim:CIMG_13337  -  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences MSETPTYSSAVLVDNHHEWKVNKILNNKACYCKRYYLVKWKEFSIEKLMWESEKNLKNTQETLKNYLKKRQNYKKTNKSTYRKKDKYKQDLEVADMFDITTDRTIMENTITEKDITDKKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.22
4 0.25
5 0.23
6 0.27
7 0.33
8 0.33
9 0.35
10 0.39
11 0.48
12 0.51
13 0.56
14 0.55
15 0.56
16 0.56
17 0.54
18 0.53
19 0.48
20 0.47
21 0.5
22 0.53
23 0.55
24 0.6
25 0.63
26 0.6
27 0.56
28 0.57
29 0.49
30 0.44
31 0.4
32 0.31
33 0.25
34 0.25
35 0.24
36 0.2
37 0.19
38 0.19
39 0.2
40 0.24
41 0.26
42 0.27
43 0.28
44 0.29
45 0.31
46 0.33
47 0.32
48 0.3
49 0.34
50 0.38
51 0.43
52 0.44
53 0.49
54 0.53
55 0.53
56 0.61
57 0.65
58 0.69
59 0.74
60 0.82
61 0.85
62 0.87
63 0.89
64 0.89
65 0.88
66 0.89
67 0.89
68 0.9
69 0.88
70 0.88
71 0.87
72 0.88
73 0.89
74 0.86
75 0.81
76 0.78
77 0.71
78 0.65
79 0.58
80 0.48
81 0.37
82 0.28
83 0.22
84 0.14
85 0.12
86 0.09
87 0.07
88 0.06
89 0.06
90 0.07
91 0.08
92 0.09
93 0.1
94 0.12
95 0.15
96 0.17
97 0.18
98 0.18
99 0.18
100 0.22