Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9Y0C5

Protein Details
Accession W9Y0C5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
203-228EHSEKKLKDCREKTIRRKREAAHRRABasic
NLS Segment(s)
PositionSequence
215-226KTIRRKREAAHR
Subcellular Location(s) mito 14, cyto_nucl 7, nucl 6.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MAFSLPVRIATPPSLILDPIFSLLYEDNEASLTHFITNKSPLPLGGVINDPAVMDYLLSREPGPKVEYKNLRPALAVLRPFLSVSLYGKKLMAFYKQLLQLQGRWAIAAAEMVTFDVYVKFYITLFIDHSDKKLADHVFKVVPGAAYSIATYTAGSREQFNLMVKAEKERLIKNTRAAAAKLFDFKVSKDFFQQHGKLVAAIEHSEKKLKDCREKTIRRKREAAHRRAAMVAAAQERNEAALHRQMGMSGLTAHVPHVEDSVVDWTEEITKECFSSKEKPVSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.17
5 0.15
6 0.15
7 0.13
8 0.1
9 0.11
10 0.11
11 0.13
12 0.13
13 0.13
14 0.11
15 0.12
16 0.12
17 0.12
18 0.12
19 0.11
20 0.11
21 0.13
22 0.14
23 0.17
24 0.22
25 0.23
26 0.25
27 0.25
28 0.23
29 0.25
30 0.26
31 0.23
32 0.2
33 0.19
34 0.17
35 0.17
36 0.17
37 0.12
38 0.1
39 0.1
40 0.08
41 0.06
42 0.05
43 0.07
44 0.07
45 0.08
46 0.09
47 0.11
48 0.12
49 0.15
50 0.18
51 0.22
52 0.26
53 0.35
54 0.43
55 0.44
56 0.53
57 0.53
58 0.5
59 0.45
60 0.42
61 0.39
62 0.36
63 0.33
64 0.24
65 0.22
66 0.22
67 0.21
68 0.2
69 0.15
70 0.11
71 0.12
72 0.16
73 0.16
74 0.17
75 0.17
76 0.17
77 0.18
78 0.19
79 0.2
80 0.18
81 0.18
82 0.23
83 0.26
84 0.27
85 0.27
86 0.27
87 0.25
88 0.25
89 0.27
90 0.21
91 0.17
92 0.16
93 0.13
94 0.12
95 0.11
96 0.08
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.05
108 0.05
109 0.07
110 0.07
111 0.07
112 0.08
113 0.09
114 0.11
115 0.11
116 0.12
117 0.13
118 0.13
119 0.12
120 0.16
121 0.16
122 0.16
123 0.17
124 0.18
125 0.16
126 0.16
127 0.16
128 0.12
129 0.1
130 0.08
131 0.08
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.04
140 0.05
141 0.07
142 0.07
143 0.08
144 0.09
145 0.1
146 0.11
147 0.12
148 0.13
149 0.12
150 0.14
151 0.14
152 0.16
153 0.17
154 0.19
155 0.21
156 0.22
157 0.28
158 0.31
159 0.33
160 0.34
161 0.37
162 0.36
163 0.36
164 0.34
165 0.29
166 0.26
167 0.24
168 0.23
169 0.19
170 0.17
171 0.16
172 0.16
173 0.2
174 0.2
175 0.2
176 0.22
177 0.25
178 0.27
179 0.35
180 0.36
181 0.33
182 0.33
183 0.33
184 0.28
185 0.25
186 0.22
187 0.15
188 0.14
189 0.15
190 0.15
191 0.16
192 0.2
193 0.2
194 0.23
195 0.29
196 0.36
197 0.44
198 0.45
199 0.55
200 0.61
201 0.71
202 0.78
203 0.82
204 0.84
205 0.8
206 0.84
207 0.8
208 0.8
209 0.8
210 0.78
211 0.77
212 0.7
213 0.65
214 0.58
215 0.52
216 0.41
217 0.32
218 0.27
219 0.22
220 0.2
221 0.18
222 0.17
223 0.16
224 0.17
225 0.16
226 0.13
227 0.11
228 0.16
229 0.17
230 0.18
231 0.18
232 0.17
233 0.18
234 0.17
235 0.15
236 0.1
237 0.09
238 0.1
239 0.1
240 0.1
241 0.11
242 0.11
243 0.11
244 0.11
245 0.1
246 0.09
247 0.11
248 0.15
249 0.14
250 0.12
251 0.12
252 0.12
253 0.15
254 0.16
255 0.16
256 0.14
257 0.14
258 0.15
259 0.17
260 0.19
261 0.21
262 0.28
263 0.35