Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9YTG6

Protein Details
Accession W9YTG6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-79GSRSSPRQKKSSHSKRPTGRBasic
NLS Segment(s)
PositionSequence
65-79PRQKKSSHSKRPTGR
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MGVPWPSSRVQHIRRPAIITATTIPVKFANVTRESDARNRIAKHSEITGYGAKQSWSSSGSRSSPRQKKSSHSKRPTGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.55
4 0.5
5 0.44
6 0.37
7 0.3
8 0.27
9 0.25
10 0.21
11 0.21
12 0.16
13 0.16
14 0.15
15 0.16
16 0.17
17 0.18
18 0.2
19 0.21
20 0.23
21 0.25
22 0.27
23 0.28
24 0.27
25 0.28
26 0.27
27 0.27
28 0.29
29 0.27
30 0.25
31 0.23
32 0.2
33 0.17
34 0.19
35 0.18
36 0.16
37 0.16
38 0.15
39 0.13
40 0.13
41 0.13
42 0.12
43 0.12
44 0.13
45 0.14
46 0.18
47 0.22
48 0.28
49 0.35
50 0.45
51 0.51
52 0.57
53 0.63
54 0.62
55 0.67
56 0.73
57 0.76
58 0.77
59 0.78