Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9YL97

Protein Details
Accession W9YL97    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
233-262SKKLSKAELKAFKEKRREKKEEKRRAWLRDBasic
NLS Segment(s)
PositionSequence
228-260RAERASKKLSKAELKAFKEKRREKKEEKRRAWL
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001202  WW_dom  
IPR036020  WW_dom_sf  
Pfam View protein in Pfam  
PF00397  WW  
PROSITE View protein in PROSITE  
PS01159  WW_DOMAIN_1  
PS50020  WW_DOMAIN_2  
CDD cd00201  WW  
Amino Acid Sequences MSALSSEKESPTDKPRQQSVDQQAEDGEISDHDTSPSESAFPEPEKTDVVNPPLPAVEPPPPLPNEAPPAEPVDDGWEPIWDDRAQAFYFFNRFTNKSQWENPRVPDAQPTVSPGIGNHERIASPADAAPARRAGGYDPAIHGDYDPNADYAKTYEDPMGSDAVGGAPVADASEIYAATGTFNRFTGKWQRAELNPEKFSDEQKSKRQMNAFFDVDAAANSHEGRSLRAERASKKLSKAELKAFKEKRREKKEEKRRAWLRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.59
4 0.61
5 0.66
6 0.68
7 0.67
8 0.62
9 0.55
10 0.48
11 0.42
12 0.38
13 0.28
14 0.18
15 0.08
16 0.11
17 0.11
18 0.11
19 0.11
20 0.12
21 0.12
22 0.13
23 0.13
24 0.11
25 0.1
26 0.12
27 0.15
28 0.16
29 0.18
30 0.18
31 0.19
32 0.2
33 0.21
34 0.24
35 0.25
36 0.28
37 0.29
38 0.27
39 0.26
40 0.25
41 0.24
42 0.2
43 0.2
44 0.2
45 0.19
46 0.21
47 0.25
48 0.25
49 0.28
50 0.28
51 0.28
52 0.28
53 0.26
54 0.26
55 0.23
56 0.25
57 0.23
58 0.21
59 0.18
60 0.18
61 0.16
62 0.16
63 0.15
64 0.12
65 0.12
66 0.12
67 0.15
68 0.1
69 0.1
70 0.1
71 0.13
72 0.13
73 0.13
74 0.14
75 0.13
76 0.15
77 0.15
78 0.17
79 0.18
80 0.21
81 0.23
82 0.3
83 0.33
84 0.35
85 0.42
86 0.48
87 0.51
88 0.52
89 0.51
90 0.49
91 0.45
92 0.41
93 0.38
94 0.32
95 0.26
96 0.23
97 0.24
98 0.19
99 0.18
100 0.17
101 0.13
102 0.17
103 0.17
104 0.18
105 0.15
106 0.15
107 0.14
108 0.15
109 0.17
110 0.1
111 0.09
112 0.08
113 0.1
114 0.09
115 0.1
116 0.1
117 0.09
118 0.09
119 0.09
120 0.09
121 0.08
122 0.12
123 0.13
124 0.13
125 0.13
126 0.14
127 0.14
128 0.14
129 0.14
130 0.1
131 0.08
132 0.09
133 0.09
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.1
140 0.09
141 0.1
142 0.11
143 0.11
144 0.11
145 0.12
146 0.12
147 0.09
148 0.08
149 0.07
150 0.06
151 0.05
152 0.05
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.02
159 0.03
160 0.03
161 0.03
162 0.03
163 0.04
164 0.04
165 0.05
166 0.07
167 0.08
168 0.08
169 0.09
170 0.11
171 0.11
172 0.15
173 0.25
174 0.29
175 0.31
176 0.34
177 0.38
178 0.39
179 0.48
180 0.52
181 0.5
182 0.46
183 0.44
184 0.44
185 0.41
186 0.41
187 0.41
188 0.41
189 0.4
190 0.47
191 0.55
192 0.55
193 0.6
194 0.63
195 0.61
196 0.6
197 0.6
198 0.52
199 0.43
200 0.39
201 0.34
202 0.27
203 0.21
204 0.15
205 0.09
206 0.08
207 0.08
208 0.08
209 0.1
210 0.11
211 0.12
212 0.18
213 0.22
214 0.25
215 0.31
216 0.37
217 0.39
218 0.48
219 0.53
220 0.52
221 0.54
222 0.57
223 0.59
224 0.61
225 0.63
226 0.64
227 0.67
228 0.68
229 0.73
230 0.75
231 0.75
232 0.77
233 0.8
234 0.81
235 0.82
236 0.86
237 0.86
238 0.89
239 0.92
240 0.93
241 0.92
242 0.92