Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XZG8

Protein Details
Accession W9XZG8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
100-127KKDASRITEKQKKRQTHFPQRKYAVKAEHydrophilic
NLS Segment(s)
PositionSequence
89-114KQTRAIRRQLSKKDASRITEKQKKRQ
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSTNAKVKPGQLWGKSKDDLKKQLDELKGELVSLRVQKIAGGASSKLTRIHDLRKSIARVLTVINANQRHQLRLFYQKKKYLPLDLRPKQTRAIRRQLSKKDASRITEKQKKRQTHFPQRKYAVKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.57
3 0.59
4 0.58
5 0.58
6 0.6
7 0.57
8 0.57
9 0.55
10 0.59
11 0.57
12 0.51
13 0.44
14 0.38
15 0.33
16 0.28
17 0.24
18 0.18
19 0.17
20 0.17
21 0.16
22 0.12
23 0.12
24 0.12
25 0.13
26 0.13
27 0.1
28 0.1
29 0.09
30 0.11
31 0.12
32 0.13
33 0.14
34 0.15
35 0.17
36 0.19
37 0.26
38 0.29
39 0.31
40 0.34
41 0.37
42 0.37
43 0.36
44 0.34
45 0.27
46 0.22
47 0.2
48 0.19
49 0.15
50 0.14
51 0.17
52 0.17
53 0.17
54 0.22
55 0.22
56 0.21
57 0.2
58 0.22
59 0.2
60 0.3
61 0.38
62 0.41
63 0.47
64 0.52
65 0.54
66 0.58
67 0.58
68 0.56
69 0.54
70 0.55
71 0.6
72 0.6
73 0.67
74 0.64
75 0.63
76 0.61
77 0.61
78 0.62
79 0.59
80 0.63
81 0.62
82 0.67
83 0.75
84 0.77
85 0.78
86 0.77
87 0.75
88 0.73
89 0.71
90 0.66
91 0.65
92 0.64
93 0.67
94 0.68
95 0.7
96 0.71
97 0.75
98 0.8
99 0.78
100 0.81
101 0.82
102 0.83
103 0.87
104 0.86
105 0.87
106 0.85
107 0.87