Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K7S4

Protein Details
Accession J3K7S4   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
69-110SPVPATPTPRKRKAREPKAPSETPVKRPRKNAKKAQDDGDNDHydrophilic
NLS Segment(s)
PositionSequence
77-102PRKRKAREPKAPSETPVKRPRKNAKK
Subcellular Location(s) mito 15, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
KEGG cim:CIMG_06260  -  
CDD cd00167  SANT  
Amino Acid Sequences MPSVWDVSSNYRLLFHMVEQCNPKVSWESVAAAMGGGFTAEACRQHFAKLKKTMSDGTANPNGNGGAGSPVPATPTPRKRKAREPKAPSETPVKRPRKNAKKAQDDGDNDEGKETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.24
4 0.25
5 0.29
6 0.32
7 0.33
8 0.33
9 0.32
10 0.31
11 0.25
12 0.24
13 0.23
14 0.2
15 0.21
16 0.18
17 0.18
18 0.16
19 0.12
20 0.11
21 0.08
22 0.05
23 0.03
24 0.03
25 0.02
26 0.03
27 0.04
28 0.06
29 0.07
30 0.09
31 0.1
32 0.14
33 0.2
34 0.24
35 0.32
36 0.39
37 0.4
38 0.4
39 0.42
40 0.4
41 0.37
42 0.37
43 0.29
44 0.26
45 0.3
46 0.28
47 0.25
48 0.24
49 0.21
50 0.16
51 0.15
52 0.1
53 0.06
54 0.05
55 0.06
56 0.06
57 0.06
58 0.08
59 0.08
60 0.13
61 0.2
62 0.3
63 0.39
64 0.49
65 0.58
66 0.62
67 0.72
68 0.79
69 0.82
70 0.82
71 0.82
72 0.83
73 0.82
74 0.79
75 0.71
76 0.7
77 0.65
78 0.63
79 0.65
80 0.65
81 0.62
82 0.71
83 0.79
84 0.8
85 0.84
86 0.85
87 0.85
88 0.86
89 0.86
90 0.82
91 0.8
92 0.74
93 0.71
94 0.68
95 0.59
96 0.48