Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9YBY4

Protein Details
Accession W9YBY4    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
52-72EAFRQCWKRKGNEERTQTKDAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010625  CHCH  
IPR039870  Coa4-like  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF06747  CHCH  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences QRIFSTGCAGSGSLEVSINDEIANLGCTEEQLRMNDCYYDKKDWRACKNEMEAFRQCWKRKGNEERTQTKDAALEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.1
5 0.09
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.05
12 0.05
13 0.05
14 0.05
15 0.06
16 0.08
17 0.09
18 0.1
19 0.12
20 0.13
21 0.14
22 0.15
23 0.15
24 0.18
25 0.2
26 0.25
27 0.24
28 0.3
29 0.36
30 0.42
31 0.49
32 0.51
33 0.51
34 0.51
35 0.56
36 0.55
37 0.52
38 0.5
39 0.46
40 0.44
41 0.49
42 0.52
43 0.48
44 0.49
45 0.52
46 0.54
47 0.61
48 0.68
49 0.71
50 0.72
51 0.78
52 0.8
53 0.81
54 0.78
55 0.68
56 0.58