Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XJ29

Protein Details
Accession W9XJ29    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-30AANSLRTKQKPLKDKYRSDPSSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR015946  KH_dom-like_a/b  
IPR003718  OsmC/Ohr_fam  
IPR036102  OsmC/Ohrsf  
Pfam View protein in Pfam  
PF02566  OsmC  
Amino Acid Sequences MSSDPALAAANSLRTKQKPLKDKYRSDPSSALVTLSSSGTLDPTSTSLTCSLSAGTAARKLAGLHKAAGGAGFDASGELCSGDMLLESLVACFGVTVRAVATSLGVPIKNGTITAAADLDFRGTMGIKDPDGNAVPVGFTKIKLSVKIDVDEEHESKVKKLIELSERYCVVLQTLKAGVPIETSLGHIDEKDGDDGAYGGNATGAPGIPNESVLRVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.36
3 0.42
4 0.5
5 0.54
6 0.62
7 0.71
8 0.74
9 0.81
10 0.82
11 0.85
12 0.79
13 0.75
14 0.68
15 0.6
16 0.55
17 0.46
18 0.37
19 0.26
20 0.23
21 0.19
22 0.16
23 0.13
24 0.08
25 0.07
26 0.08
27 0.08
28 0.07
29 0.07
30 0.08
31 0.1
32 0.1
33 0.12
34 0.12
35 0.13
36 0.13
37 0.13
38 0.12
39 0.09
40 0.1
41 0.1
42 0.1
43 0.11
44 0.11
45 0.11
46 0.11
47 0.12
48 0.16
49 0.19
50 0.19
51 0.17
52 0.18
53 0.18
54 0.17
55 0.17
56 0.12
57 0.08
58 0.06
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.02
80 0.03
81 0.03
82 0.03
83 0.03
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.04
90 0.05
91 0.06
92 0.06
93 0.05
94 0.06
95 0.06
96 0.06
97 0.05
98 0.05
99 0.05
100 0.05
101 0.06
102 0.06
103 0.05
104 0.06
105 0.06
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.07
113 0.08
114 0.08
115 0.09
116 0.09
117 0.11
118 0.12
119 0.12
120 0.09
121 0.08
122 0.08
123 0.07
124 0.1
125 0.08
126 0.08
127 0.09
128 0.14
129 0.15
130 0.17
131 0.2
132 0.22
133 0.24
134 0.25
135 0.25
136 0.21
137 0.24
138 0.26
139 0.24
140 0.2
141 0.21
142 0.2
143 0.2
144 0.24
145 0.21
146 0.19
147 0.2
148 0.25
149 0.29
150 0.35
151 0.38
152 0.38
153 0.38
154 0.38
155 0.36
156 0.29
157 0.23
158 0.2
159 0.17
160 0.15
161 0.16
162 0.15
163 0.16
164 0.16
165 0.15
166 0.12
167 0.12
168 0.1
169 0.09
170 0.1
171 0.1
172 0.11
173 0.11
174 0.1
175 0.11
176 0.12
177 0.13
178 0.13
179 0.12
180 0.11
181 0.11
182 0.11
183 0.1
184 0.08
185 0.06
186 0.05
187 0.05
188 0.05
189 0.05
190 0.06
191 0.06
192 0.06
193 0.07
194 0.1
195 0.1
196 0.12
197 0.13