Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9YX91

Protein Details
Accession W9YX91   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
373-399ANELHSQSKSKKTKKSQSKSDKADSVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007052  CS_dom  
IPR008978  HSP20-like_chaperone  
IPR007699  SGS_dom  
IPR044563  Sgt1-like  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF04969  CS  
PF05002  SGS  
PROSITE View protein in PROSITE  
PS51203  CS  
PS51048  SGS  
CDD cd06466  p23_CS_SGT1_like  
Amino Acid Sequences MAHAARGAAALAASDGPAALSAYTQALIEHPNSPDYYVQRSTAFTRIKPPRYDLALKDAEYAVALGYKRAVREKIQAGQQRRVVALYGLGRYADAKYLLTTMVRWRPHDSKTAKMEGDMWMARVESKLKQVPDSEKVVTIKERPEIEVLPEDKLRQLFKAQLNMDGSYKLDDSTSLKSTTTPTTNTNGTTTTMTASDNSAATTAMPSASAAGSAAADVPKIRHEWYQNAQSVTLTLYAKGVPKDTAEIEIKEDSVYISFPHPANPSATFTFSLDPLFALIDPSQSKFSIMSTKIELTLKKLQPGQKWHNLEGTTPLQPSTQNENVTQNDVSVSSAKAPPLVSTLPTTQSTSAATVPAYPTSSRHGPKDWDKLANELHSQSKSKKTKKSQSKSDKADSVSKPAAEADINANDSPPGSGDEAGDDVDSDYETGDAVDGFFKKLYAGADPDTRRAMMKSFYESKGTALSTNWSEVGKAPVKEVNSKNDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.06
6 0.05
7 0.05
8 0.06
9 0.07
10 0.08
11 0.08
12 0.07
13 0.09
14 0.11
15 0.13
16 0.16
17 0.17
18 0.19
19 0.2
20 0.22
21 0.25
22 0.26
23 0.31
24 0.29
25 0.3
26 0.29
27 0.32
28 0.34
29 0.38
30 0.39
31 0.34
32 0.42
33 0.49
34 0.56
35 0.57
36 0.59
37 0.58
38 0.61
39 0.65
40 0.58
41 0.57
42 0.54
43 0.5
44 0.47
45 0.4
46 0.32
47 0.25
48 0.23
49 0.14
50 0.12
51 0.11
52 0.09
53 0.12
54 0.14
55 0.17
56 0.22
57 0.25
58 0.26
59 0.34
60 0.4
61 0.43
62 0.5
63 0.56
64 0.57
65 0.61
66 0.61
67 0.55
68 0.49
69 0.43
70 0.35
71 0.28
72 0.26
73 0.22
74 0.19
75 0.16
76 0.16
77 0.15
78 0.15
79 0.15
80 0.13
81 0.11
82 0.1
83 0.1
84 0.11
85 0.12
86 0.11
87 0.12
88 0.17
89 0.24
90 0.27
91 0.29
92 0.35
93 0.4
94 0.43
95 0.51
96 0.47
97 0.48
98 0.51
99 0.55
100 0.48
101 0.44
102 0.43
103 0.36
104 0.37
105 0.29
106 0.23
107 0.17
108 0.17
109 0.16
110 0.16
111 0.16
112 0.13
113 0.19
114 0.23
115 0.24
116 0.27
117 0.31
118 0.36
119 0.38
120 0.4
121 0.35
122 0.34
123 0.34
124 0.33
125 0.31
126 0.29
127 0.27
128 0.28
129 0.28
130 0.25
131 0.27
132 0.25
133 0.25
134 0.28
135 0.26
136 0.24
137 0.23
138 0.22
139 0.22
140 0.24
141 0.22
142 0.17
143 0.18
144 0.23
145 0.25
146 0.32
147 0.31
148 0.33
149 0.34
150 0.34
151 0.32
152 0.25
153 0.22
154 0.16
155 0.16
156 0.11
157 0.09
158 0.09
159 0.11
160 0.14
161 0.16
162 0.15
163 0.15
164 0.16
165 0.19
166 0.21
167 0.21
168 0.2
169 0.2
170 0.23
171 0.24
172 0.24
173 0.23
174 0.2
175 0.19
176 0.17
177 0.15
178 0.12
179 0.11
180 0.11
181 0.1
182 0.1
183 0.09
184 0.08
185 0.08
186 0.07
187 0.07
188 0.06
189 0.06
190 0.06
191 0.04
192 0.04
193 0.04
194 0.05
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.05
206 0.06
207 0.07
208 0.09
209 0.12
210 0.15
211 0.2
212 0.25
213 0.32
214 0.34
215 0.33
216 0.32
217 0.28
218 0.26
219 0.21
220 0.19
221 0.12
222 0.09
223 0.09
224 0.1
225 0.12
226 0.12
227 0.12
228 0.1
229 0.1
230 0.11
231 0.11
232 0.14
233 0.13
234 0.13
235 0.14
236 0.14
237 0.14
238 0.12
239 0.11
240 0.08
241 0.07
242 0.06
243 0.05
244 0.06
245 0.08
246 0.08
247 0.12
248 0.13
249 0.14
250 0.15
251 0.16
252 0.19
253 0.17
254 0.19
255 0.17
256 0.16
257 0.16
258 0.14
259 0.13
260 0.09
261 0.08
262 0.07
263 0.06
264 0.05
265 0.06
266 0.06
267 0.08
268 0.09
269 0.1
270 0.11
271 0.11
272 0.12
273 0.11
274 0.12
275 0.16
276 0.17
277 0.17
278 0.18
279 0.19
280 0.21
281 0.23
282 0.22
283 0.21
284 0.29
285 0.28
286 0.3
287 0.34
288 0.37
289 0.41
290 0.5
291 0.52
292 0.51
293 0.54
294 0.52
295 0.52
296 0.47
297 0.42
298 0.38
299 0.34
300 0.27
301 0.23
302 0.22
303 0.17
304 0.18
305 0.21
306 0.23
307 0.25
308 0.25
309 0.26
310 0.31
311 0.31
312 0.33
313 0.29
314 0.22
315 0.18
316 0.16
317 0.15
318 0.11
319 0.1
320 0.1
321 0.12
322 0.12
323 0.13
324 0.13
325 0.13
326 0.15
327 0.15
328 0.14
329 0.15
330 0.17
331 0.18
332 0.2
333 0.21
334 0.18
335 0.18
336 0.18
337 0.17
338 0.15
339 0.13
340 0.12
341 0.11
342 0.12
343 0.12
344 0.13
345 0.12
346 0.13
347 0.18
348 0.25
349 0.27
350 0.29
351 0.32
352 0.37
353 0.45
354 0.54
355 0.53
356 0.52
357 0.5
358 0.51
359 0.51
360 0.47
361 0.42
362 0.34
363 0.34
364 0.31
365 0.34
366 0.34
367 0.41
368 0.47
369 0.53
370 0.61
371 0.67
372 0.74
373 0.82
374 0.87
375 0.88
376 0.89
377 0.91
378 0.89
379 0.86
380 0.81
381 0.74
382 0.73
383 0.64
384 0.6
385 0.53
386 0.45
387 0.38
388 0.32
389 0.3
390 0.21
391 0.2
392 0.17
393 0.17
394 0.19
395 0.19
396 0.18
397 0.17
398 0.17
399 0.15
400 0.12
401 0.11
402 0.1
403 0.11
404 0.11
405 0.12
406 0.12
407 0.12
408 0.11
409 0.09
410 0.08
411 0.08
412 0.08
413 0.06
414 0.06
415 0.05
416 0.05
417 0.05
418 0.05
419 0.05
420 0.05
421 0.08
422 0.09
423 0.11
424 0.11
425 0.11
426 0.11
427 0.13
428 0.14
429 0.14
430 0.17
431 0.2
432 0.28
433 0.31
434 0.34
435 0.34
436 0.33
437 0.31
438 0.29
439 0.29
440 0.26
441 0.28
442 0.32
443 0.37
444 0.38
445 0.41
446 0.4
447 0.39
448 0.37
449 0.34
450 0.28
451 0.22
452 0.25
453 0.23
454 0.25
455 0.25
456 0.21
457 0.2
458 0.21
459 0.28
460 0.29
461 0.27
462 0.28
463 0.3
464 0.34
465 0.42
466 0.45