Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D8JYU0

Protein Details
Accession A0A0D8JYU0    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-71VQFIKPVLEKQKKKKKKKEKKKKKKKKKKEEKKKEKENYNNDKNNNBasic
NLS Segment(s)
PositionSequence
35-61KQKKKKKKKEKKKKKKKKKKEEKKKEK
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
KEGG cim:CIMG_13666  -  
Amino Acid Sequences MAEKNIYQINADDMKLILDINIRAFVQFIKPVLEKQKKKKKKKEKKKKKKKKKKEEKKKEKENYNNDKNNNNDKNDDNNNNDELTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.09
5 0.08
6 0.09
7 0.09
8 0.11
9 0.1
10 0.1
11 0.11
12 0.11
13 0.11
14 0.11
15 0.11
16 0.13
17 0.14
18 0.17
19 0.27
20 0.36
21 0.41
22 0.5
23 0.61
24 0.68
25 0.78
26 0.86
27 0.88
28 0.89
29 0.94
30 0.95
31 0.95
32 0.96
33 0.97
34 0.98
35 0.98
36 0.98
37 0.98
38 0.98
39 0.98
40 0.98
41 0.98
42 0.98
43 0.98
44 0.97
45 0.97
46 0.95
47 0.94
48 0.93
49 0.92
50 0.91
51 0.9
52 0.87
53 0.79
54 0.76
55 0.73
56 0.73
57 0.69
58 0.62
59 0.56
60 0.51
61 0.56
62 0.58
63 0.58
64 0.52
65 0.5
66 0.48