Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9Y293

Protein Details
Accession W9Y293    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPHPRPRPRPRRLQHIQGIGVBasic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 6, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004839  Aminotransferase_I/II  
IPR015424  PyrdxlP-dep_Trfase  
IPR015421  PyrdxlP-dep_Trfase_major  
IPR015422  PyrdxlP-dep_Trfase_small  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0030170  F:pyridoxal phosphate binding  
GO:0009058  P:biosynthetic process  
Pfam View protein in Pfam  
PF00155  Aminotran_1_2  
CDD cd00609  AAT_like  
Amino Acid Sequences MPHPRPRPRPRRLQHIQGIGVDQMGNLTDASDRDYLRLENLDVDIPPDPVAVAYAEQALHQDDCNSYLPFTGQAHLRDVAAKHVSQLSGVGYSGERNCVIAAGGLSGILNVLLATIEEGDEVIMTDPIYRGLINRVLLAGGVPKFVPLIFQPGGEWKLDRDALRSAITDRTTAMLLMSPSMPTGACFDQDDWDLVSELCVSKDLLLILDSAMERLVFDNLPIVHPASLPGMRSERSPWDPRPRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.76
4 0.67
5 0.6
6 0.49
7 0.41
8 0.31
9 0.21
10 0.13
11 0.1
12 0.08
13 0.06
14 0.06
15 0.07
16 0.07
17 0.11
18 0.14
19 0.13
20 0.14
21 0.16
22 0.16
23 0.17
24 0.19
25 0.16
26 0.15
27 0.16
28 0.16
29 0.14
30 0.15
31 0.14
32 0.13
33 0.12
34 0.1
35 0.09
36 0.07
37 0.08
38 0.07
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.08
45 0.09
46 0.09
47 0.09
48 0.1
49 0.09
50 0.12
51 0.15
52 0.14
53 0.13
54 0.12
55 0.13
56 0.14
57 0.15
58 0.14
59 0.15
60 0.16
61 0.18
62 0.19
63 0.18
64 0.18
65 0.18
66 0.21
67 0.19
68 0.17
69 0.16
70 0.17
71 0.17
72 0.14
73 0.14
74 0.1
75 0.08
76 0.08
77 0.08
78 0.06
79 0.08
80 0.09
81 0.09
82 0.09
83 0.08
84 0.08
85 0.08
86 0.08
87 0.06
88 0.06
89 0.04
90 0.04
91 0.04
92 0.04
93 0.03
94 0.03
95 0.03
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.05
116 0.04
117 0.05
118 0.07
119 0.1
120 0.1
121 0.1
122 0.1
123 0.09
124 0.09
125 0.09
126 0.09
127 0.07
128 0.07
129 0.07
130 0.06
131 0.07
132 0.07
133 0.08
134 0.05
135 0.11
136 0.11
137 0.11
138 0.12
139 0.15
140 0.16
141 0.16
142 0.16
143 0.1
144 0.13
145 0.16
146 0.16
147 0.15
148 0.16
149 0.18
150 0.19
151 0.19
152 0.17
153 0.19
154 0.19
155 0.17
156 0.15
157 0.15
158 0.14
159 0.13
160 0.11
161 0.09
162 0.08
163 0.09
164 0.09
165 0.08
166 0.07
167 0.08
168 0.08
169 0.06
170 0.1
171 0.1
172 0.11
173 0.12
174 0.13
175 0.15
176 0.16
177 0.16
178 0.13
179 0.13
180 0.13
181 0.11
182 0.11
183 0.1
184 0.09
185 0.09
186 0.09
187 0.08
188 0.08
189 0.09
190 0.09
191 0.08
192 0.08
193 0.08
194 0.07
195 0.09
196 0.09
197 0.07
198 0.08
199 0.07
200 0.07
201 0.08
202 0.1
203 0.08
204 0.08
205 0.12
206 0.13
207 0.14
208 0.16
209 0.16
210 0.14
211 0.14
212 0.16
213 0.16
214 0.17
215 0.17
216 0.2
217 0.22
218 0.23
219 0.25
220 0.28
221 0.31
222 0.37
223 0.44
224 0.49