Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9Y078

Protein Details
Accession W9Y078    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
110-139VAPTRHKAKEVKRRTKTGCLTCRKRRIKVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 6, extr 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MTTAAFQASTAPISLPPISSIDFHAHVAHRSSPEVVQPLPPPPPAAPRVLPPLPYPYAARPAPPPPPPPPPRIPHDYLHARPIYPGIPSSYQPMPARIPLPSTTDPHLIVAPTRHKAKEVKRRTKTGCLTCRKRRIKVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.14
5 0.15
6 0.15
7 0.17
8 0.17
9 0.18
10 0.19
11 0.2
12 0.2
13 0.21
14 0.22
15 0.23
16 0.21
17 0.21
18 0.21
19 0.19
20 0.21
21 0.22
22 0.2
23 0.2
24 0.2
25 0.22
26 0.23
27 0.22
28 0.21
29 0.2
30 0.24
31 0.23
32 0.25
33 0.23
34 0.23
35 0.3
36 0.29
37 0.29
38 0.25
39 0.28
40 0.26
41 0.26
42 0.25
43 0.2
44 0.25
45 0.23
46 0.23
47 0.21
48 0.24
49 0.28
50 0.3
51 0.32
52 0.31
53 0.4
54 0.43
55 0.45
56 0.48
57 0.46
58 0.47
59 0.49
60 0.49
61 0.41
62 0.44
63 0.45
64 0.41
65 0.42
66 0.38
67 0.32
68 0.28
69 0.28
70 0.21
71 0.14
72 0.14
73 0.11
74 0.13
75 0.13
76 0.17
77 0.17
78 0.22
79 0.22
80 0.24
81 0.23
82 0.23
83 0.24
84 0.2
85 0.22
86 0.19
87 0.25
88 0.24
89 0.26
90 0.27
91 0.28
92 0.28
93 0.26
94 0.25
95 0.19
96 0.18
97 0.21
98 0.24
99 0.27
100 0.31
101 0.3
102 0.34
103 0.41
104 0.5
105 0.55
106 0.61
107 0.66
108 0.7
109 0.79
110 0.82
111 0.84
112 0.84
113 0.83
114 0.82
115 0.82
116 0.84
117 0.85
118 0.89
119 0.88