Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9YF34

Protein Details
Accession W9YF34    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
106-131KMAEKMHKKLVERRKRREKRNKLLKSBasic
NLS Segment(s)
PositionSequence
91-131IRDRRKAKEEKERYEKMAEKMHKKLVERRKRREKRNKLLKS
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSVDTTTAPQAAAGSTSAAVPADSAQTAQKPGMRVNGKNWHAPKKPFRPTAGQTSYAKRKEQDEIKRAIKAKEQELKDEQEQERAHRIQVIRDRRKAKEEKERYEKMAEKMHKKLVERRKRREKRNKLLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.07
6 0.07
7 0.06
8 0.06
9 0.07
10 0.07
11 0.08
12 0.09
13 0.1
14 0.12
15 0.13
16 0.15
17 0.16
18 0.17
19 0.26
20 0.29
21 0.3
22 0.36
23 0.44
24 0.44
25 0.5
26 0.53
27 0.54
28 0.55
29 0.61
30 0.63
31 0.63
32 0.7
33 0.68
34 0.66
35 0.64
36 0.62
37 0.64
38 0.58
39 0.53
40 0.46
41 0.48
42 0.53
43 0.48
44 0.46
45 0.37
46 0.35
47 0.37
48 0.43
49 0.45
50 0.43
51 0.46
52 0.47
53 0.5
54 0.49
55 0.44
56 0.4
57 0.35
58 0.36
59 0.37
60 0.35
61 0.36
62 0.37
63 0.4
64 0.37
65 0.4
66 0.33
67 0.33
68 0.33
69 0.31
70 0.34
71 0.31
72 0.3
73 0.27
74 0.27
75 0.27
76 0.35
77 0.44
78 0.46
79 0.53
80 0.59
81 0.58
82 0.66
83 0.67
84 0.67
85 0.68
86 0.69
87 0.71
88 0.75
89 0.76
90 0.71
91 0.7
92 0.67
93 0.61
94 0.6
95 0.58
96 0.56
97 0.58
98 0.62
99 0.59
100 0.58
101 0.63
102 0.65
103 0.68
104 0.71
105 0.76
106 0.8
107 0.85
108 0.92
109 0.94
110 0.94
111 0.94