Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KJS9

Protein Details
Accession J3KJS9    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGAIRRSKTKRRTRDYDQVRNDIDHydrophilic
61-84NLTAHRKGKNHKRRIRLLKEEPHTBasic
NLS Segment(s)
PositionSequence
66-76RKGKNHKRRIR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG cim:CIMG_01726  -  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGAIRRSKTKRRTRDYDQVRNDIDSARHLELYKETKDVEDLPGLGQYYCVECSKWFESEYNLTAHRKGKNHKRRIRLLKEEPHTQKLAEAAVGLTSDNGKRGDGDAMQITESNEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.87
4 0.84
5 0.8
6 0.72
7 0.65
8 0.56
9 0.48
10 0.38
11 0.31
12 0.28
13 0.22
14 0.22
15 0.2
16 0.21
17 0.23
18 0.27
19 0.25
20 0.22
21 0.21
22 0.2
23 0.21
24 0.21
25 0.17
26 0.14
27 0.12
28 0.11
29 0.12
30 0.12
31 0.1
32 0.09
33 0.07
34 0.08
35 0.09
36 0.09
37 0.08
38 0.08
39 0.13
40 0.14
41 0.15
42 0.15
43 0.14
44 0.16
45 0.18
46 0.19
47 0.16
48 0.17
49 0.17
50 0.19
51 0.23
52 0.25
53 0.28
54 0.36
55 0.45
56 0.54
57 0.64
58 0.68
59 0.73
60 0.78
61 0.84
62 0.85
63 0.84
64 0.83
65 0.81
66 0.79
67 0.8
68 0.75
69 0.68
70 0.59
71 0.49
72 0.41
73 0.33
74 0.28
75 0.18
76 0.13
77 0.09
78 0.08
79 0.08
80 0.07
81 0.06
82 0.08
83 0.08
84 0.11
85 0.11
86 0.11
87 0.12
88 0.14
89 0.17
90 0.15
91 0.19
92 0.19
93 0.2
94 0.2
95 0.2