Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3KBC4

Protein Details
Accession J3KBC4    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
141-172LTAIASPPTLRRRRRRCRRRSPLPLPHHSPSLHydrophilic
NLS Segment(s)
PositionSequence
151-161RRRRRRCRRRS
Subcellular Location(s) nucl 17, mito 7, cyto 2
Family & Domain DBs
KEGG cim:CIMG_13714  -  
Amino Acid Sequences MAEWPFFTSRLLPARRDDVACHGGLFYTVPVRVVQSGYGSDVGPTRLDALVLSPDANRRAIHPPLPPPPPPPPQQPPTITTTITATPDGHEAQFRSCLTECQSCWLPVHQSRLSSGGARLRNSPYLPSSSWRVLPPVPRSLTAIASPPTLRRRRRRCRRRSPLPLPHHSPSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.42
4 0.38
5 0.37
6 0.37
7 0.34
8 0.29
9 0.24
10 0.2
11 0.19
12 0.17
13 0.1
14 0.09
15 0.09
16 0.1
17 0.1
18 0.11
19 0.12
20 0.12
21 0.12
22 0.11
23 0.12
24 0.13
25 0.13
26 0.12
27 0.11
28 0.12
29 0.12
30 0.11
31 0.1
32 0.1
33 0.09
34 0.09
35 0.08
36 0.08
37 0.09
38 0.09
39 0.09
40 0.08
41 0.11
42 0.13
43 0.14
44 0.13
45 0.15
46 0.2
47 0.22
48 0.26
49 0.27
50 0.32
51 0.37
52 0.41
53 0.39
54 0.38
55 0.42
56 0.43
57 0.43
58 0.45
59 0.45
60 0.44
61 0.48
62 0.46
63 0.42
64 0.42
65 0.4
66 0.32
67 0.26
68 0.25
69 0.2
70 0.18
71 0.16
72 0.11
73 0.1
74 0.11
75 0.12
76 0.1
77 0.1
78 0.09
79 0.1
80 0.13
81 0.12
82 0.14
83 0.13
84 0.14
85 0.17
86 0.21
87 0.2
88 0.21
89 0.23
90 0.21
91 0.21
92 0.22
93 0.24
94 0.23
95 0.31
96 0.28
97 0.27
98 0.27
99 0.29
100 0.28
101 0.23
102 0.22
103 0.22
104 0.24
105 0.24
106 0.26
107 0.27
108 0.29
109 0.29
110 0.29
111 0.25
112 0.26
113 0.26
114 0.26
115 0.28
116 0.27
117 0.29
118 0.27
119 0.28
120 0.27
121 0.33
122 0.35
123 0.38
124 0.38
125 0.36
126 0.38
127 0.37
128 0.36
129 0.3
130 0.29
131 0.22
132 0.22
133 0.23
134 0.25
135 0.33
136 0.4
137 0.48
138 0.55
139 0.65
140 0.74
141 0.84
142 0.9
143 0.91
144 0.94
145 0.96
146 0.96
147 0.96
148 0.96
149 0.95
150 0.94
151 0.92
152 0.89