Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9XN77

Protein Details
Accession W9XN77   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
155-181APPPPPPPAKIRRKRRGSKKIFRSTSTHydrophilic
NLS Segment(s)
PositionSequence
158-175PPPPPAKIRRKRRGSKKI
Subcellular Location(s) nucl 16, cyto 6, mito 5
Family & Domain DBs
Amino Acid Sequences MGCLCSRFSKAAEEPTSLPLPTPVSATPVPAPLSSPVADFEPTPEPEQAPPPPAAPAAAATAPPPPPETDLSWRGWPGLLNHEERAAGVVVGARPLSEDSEPGQAPAPAATKPSRRKRLVNSLFRSSSRSSSSGSSSWTTVKCRTETEESQPLQAPPPPPPPAKIRRKRRGSKKIFRSTSTDTSGSVYSQACSTKSRSTILYHESEDWPAPVRWPEPEHDPAAPAMPAVKIIAATDSEVAEEGPIRGRLLFPQSFEFLRSEWYKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.43
3 0.43
4 0.35
5 0.31
6 0.24
7 0.23
8 0.2
9 0.21
10 0.16
11 0.2
12 0.2
13 0.23
14 0.22
15 0.23
16 0.24
17 0.21
18 0.23
19 0.19
20 0.22
21 0.19
22 0.18
23 0.16
24 0.16
25 0.17
26 0.15
27 0.16
28 0.18
29 0.2
30 0.22
31 0.22
32 0.22
33 0.23
34 0.28
35 0.27
36 0.25
37 0.24
38 0.22
39 0.22
40 0.21
41 0.19
42 0.15
43 0.13
44 0.12
45 0.11
46 0.11
47 0.1
48 0.13
49 0.14
50 0.14
51 0.14
52 0.13
53 0.15
54 0.18
55 0.22
56 0.25
57 0.28
58 0.3
59 0.31
60 0.3
61 0.28
62 0.26
63 0.23
64 0.19
65 0.22
66 0.23
67 0.24
68 0.24
69 0.24
70 0.23
71 0.22
72 0.21
73 0.13
74 0.09
75 0.07
76 0.08
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.07
83 0.08
84 0.07
85 0.08
86 0.09
87 0.13
88 0.13
89 0.13
90 0.14
91 0.12
92 0.12
93 0.12
94 0.12
95 0.08
96 0.11
97 0.14
98 0.21
99 0.31
100 0.41
101 0.49
102 0.52
103 0.58
104 0.63
105 0.71
106 0.73
107 0.73
108 0.69
109 0.65
110 0.63
111 0.58
112 0.54
113 0.44
114 0.37
115 0.3
116 0.26
117 0.21
118 0.2
119 0.22
120 0.19
121 0.2
122 0.18
123 0.16
124 0.17
125 0.17
126 0.19
127 0.2
128 0.22
129 0.21
130 0.22
131 0.25
132 0.29
133 0.3
134 0.33
135 0.37
136 0.35
137 0.36
138 0.36
139 0.32
140 0.27
141 0.27
142 0.22
143 0.18
144 0.24
145 0.27
146 0.26
147 0.29
148 0.35
149 0.43
150 0.52
151 0.58
152 0.63
153 0.69
154 0.79
155 0.86
156 0.9
157 0.91
158 0.91
159 0.91
160 0.91
161 0.91
162 0.85
163 0.78
164 0.74
165 0.7
166 0.64
167 0.58
168 0.48
169 0.38
170 0.35
171 0.33
172 0.26
173 0.21
174 0.16
175 0.11
176 0.13
177 0.13
178 0.13
179 0.15
180 0.18
181 0.21
182 0.23
183 0.24
184 0.25
185 0.27
186 0.31
187 0.33
188 0.33
189 0.3
190 0.31
191 0.3
192 0.3
193 0.27
194 0.23
195 0.21
196 0.18
197 0.18
198 0.18
199 0.18
200 0.21
201 0.23
202 0.25
203 0.28
204 0.32
205 0.33
206 0.3
207 0.3
208 0.27
209 0.26
210 0.23
211 0.16
212 0.13
213 0.1
214 0.1
215 0.09
216 0.08
217 0.07
218 0.07
219 0.08
220 0.08
221 0.09
222 0.09
223 0.09
224 0.09
225 0.09
226 0.09
227 0.08
228 0.08
229 0.08
230 0.11
231 0.12
232 0.12
233 0.13
234 0.14
235 0.17
236 0.25
237 0.26
238 0.25
239 0.28
240 0.31
241 0.31
242 0.32
243 0.3
244 0.22
245 0.27