Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K5T8

Protein Details
Accession J3K5T8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
120-145LEEQEEKEEKKKKKREEKNNDNDEDDAcidic
NLS Segment(s)
PositionSequence
128-135EKKKKKRE
Subcellular Location(s) mito 12.5, mito_nucl 11.833, nucl 10, cyto_nucl 6.833
Family & Domain DBs
KEGG cim:CIMG_13188  -  
Amino Acid Sequences MNIAGNVLPLSHFRRWLKQSCTLCLSHIMVNTNNMKLILGIGAKIRLNYFSLIDAPDHPTPATTTHHLCAAPTPLTTTAATPPPPPLPTTAFLPPSSTIRVSACQMAGIRAPVQFTKPVLEEQEEKEEKKKKKREEKNNDNDEDDDDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.46
3 0.53
4 0.56
5 0.6
6 0.62
7 0.6
8 0.61
9 0.53
10 0.47
11 0.43
12 0.39
13 0.32
14 0.29
15 0.26
16 0.23
17 0.27
18 0.29
19 0.25
20 0.23
21 0.2
22 0.18
23 0.14
24 0.14
25 0.1
26 0.08
27 0.08
28 0.08
29 0.1
30 0.11
31 0.11
32 0.11
33 0.11
34 0.12
35 0.12
36 0.12
37 0.1
38 0.11
39 0.11
40 0.12
41 0.12
42 0.15
43 0.15
44 0.15
45 0.13
46 0.13
47 0.13
48 0.14
49 0.16
50 0.14
51 0.16
52 0.15
53 0.18
54 0.17
55 0.17
56 0.15
57 0.15
58 0.13
59 0.11
60 0.12
61 0.1
62 0.12
63 0.12
64 0.12
65 0.11
66 0.12
67 0.13
68 0.13
69 0.14
70 0.15
71 0.15
72 0.15
73 0.16
74 0.17
75 0.18
76 0.21
77 0.22
78 0.22
79 0.21
80 0.23
81 0.21
82 0.2
83 0.21
84 0.18
85 0.16
86 0.15
87 0.17
88 0.17
89 0.17
90 0.15
91 0.15
92 0.15
93 0.14
94 0.14
95 0.13
96 0.13
97 0.12
98 0.13
99 0.12
100 0.14
101 0.15
102 0.15
103 0.17
104 0.17
105 0.19
106 0.2
107 0.23
108 0.24
109 0.25
110 0.34
111 0.34
112 0.35
113 0.4
114 0.47
115 0.52
116 0.6
117 0.65
118 0.66
119 0.75
120 0.84
121 0.88
122 0.9
123 0.93
124 0.93
125 0.94
126 0.87
127 0.79
128 0.69
129 0.61