Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W9Y5V7

Protein Details
Accession W9Y5V7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
89-132LDLRPKQTRAIRRRLSKKDASRVTEKQKKRQTHFPQRKYAVKAEHydrophilic
NLS Segment(s)
PositionSequence
92-119RPKQTRAIRRRLSKKDASRVTEKQKKRQ
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MVRSSESHEINFKPGQLWGKSKDDLKKQLDELKGELVQLRVQKIAGGATSKLTRIHDLRKSIARVLTVINANQRHQLRLFYEKKKYLPLDLRPKQTRAIRRRLSKKDASRVTEKQKKRQTHFPQRKYAVKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.3
4 0.34
5 0.34
6 0.38
7 0.41
8 0.46
9 0.5
10 0.52
11 0.57
12 0.56
13 0.55
14 0.54
15 0.58
16 0.55
17 0.49
18 0.42
19 0.37
20 0.33
21 0.28
22 0.26
23 0.19
24 0.18
25 0.19
26 0.18
27 0.14
28 0.14
29 0.14
30 0.13
31 0.13
32 0.11
33 0.1
34 0.09
35 0.11
36 0.12
37 0.12
38 0.14
39 0.14
40 0.17
41 0.18
42 0.25
43 0.28
44 0.3
45 0.33
46 0.35
47 0.36
48 0.34
49 0.33
50 0.26
51 0.22
52 0.19
53 0.19
54 0.15
55 0.14
56 0.17
57 0.17
58 0.17
59 0.22
60 0.22
61 0.21
62 0.21
63 0.22
64 0.2
65 0.29
66 0.35
67 0.36
68 0.43
69 0.45
70 0.46
71 0.5
72 0.49
73 0.47
74 0.47
75 0.5
76 0.54
77 0.56
78 0.64
79 0.62
80 0.62
81 0.62
82 0.62
83 0.63
84 0.6
85 0.64
86 0.64
87 0.7
88 0.78
89 0.8
90 0.82
91 0.81
92 0.82
93 0.82
94 0.81
95 0.77
96 0.75
97 0.74
98 0.76
99 0.76
100 0.75
101 0.75
102 0.76
103 0.8
104 0.78
105 0.81
106 0.82
107 0.83
108 0.87
109 0.86
110 0.87
111 0.85
112 0.87