Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E1RWN1

Protein Details
Accession A0A0E1RWN1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
120-152EEMKRKDEEKTEKNRKKREKRKAAKAKKGTGEABasic
NLS Segment(s)
PositionSequence
117-149KKREEMKRKDEEKTEKNRKKREKRKAAKAKKGT
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
KEGG cim:CIMG_03456  -  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MQLYISCVLEHNRLRISSSKVIVDCAKIHYFSNHAKQLDTLFKDPSKEIHIPATSKPRTAASLAPPPEIVANVQGSSAGAGSGEFHVYKASRRREYERVRLMEDELNREKANEEFEKKREEMKRKDEEKTEKNRKKREKRKAAKAKKGTGEAGNATGKADGRTGVGVLNGPVLRENGHEGPAQSEPCEDHTEVPGVIIHDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.41
4 0.4
5 0.4
6 0.41
7 0.37
8 0.4
9 0.39
10 0.37
11 0.31
12 0.3
13 0.29
14 0.25
15 0.26
16 0.24
17 0.27
18 0.31
19 0.38
20 0.39
21 0.37
22 0.36
23 0.37
24 0.39
25 0.42
26 0.4
27 0.33
28 0.31
29 0.32
30 0.34
31 0.33
32 0.31
33 0.3
34 0.27
35 0.26
36 0.28
37 0.3
38 0.3
39 0.34
40 0.41
41 0.36
42 0.35
43 0.35
44 0.3
45 0.29
46 0.29
47 0.28
48 0.23
49 0.31
50 0.31
51 0.3
52 0.28
53 0.27
54 0.25
55 0.21
56 0.16
57 0.09
58 0.09
59 0.08
60 0.08
61 0.08
62 0.07
63 0.07
64 0.06
65 0.04
66 0.03
67 0.03
68 0.04
69 0.04
70 0.05
71 0.05
72 0.05
73 0.07
74 0.07
75 0.12
76 0.19
77 0.26
78 0.31
79 0.35
80 0.41
81 0.49
82 0.56
83 0.61
84 0.61
85 0.56
86 0.53
87 0.49
88 0.46
89 0.39
90 0.33
91 0.29
92 0.23
93 0.23
94 0.21
95 0.2
96 0.19
97 0.16
98 0.2
99 0.18
100 0.21
101 0.23
102 0.25
103 0.3
104 0.3
105 0.37
106 0.4
107 0.45
108 0.49
109 0.54
110 0.62
111 0.62
112 0.66
113 0.67
114 0.68
115 0.67
116 0.7
117 0.72
118 0.71
119 0.75
120 0.81
121 0.84
122 0.86
123 0.88
124 0.89
125 0.89
126 0.91
127 0.93
128 0.94
129 0.94
130 0.94
131 0.92
132 0.89
133 0.83
134 0.77
135 0.69
136 0.6
137 0.53
138 0.43
139 0.38
140 0.31
141 0.25
142 0.21
143 0.19
144 0.17
145 0.14
146 0.13
147 0.09
148 0.09
149 0.1
150 0.1
151 0.09
152 0.09
153 0.09
154 0.08
155 0.12
156 0.11
157 0.11
158 0.12
159 0.12
160 0.12
161 0.13
162 0.19
163 0.16
164 0.18
165 0.2
166 0.19
167 0.22
168 0.25
169 0.25
170 0.19
171 0.19
172 0.18
173 0.21
174 0.25
175 0.23
176 0.21
177 0.23
178 0.25
179 0.23
180 0.22
181 0.2
182 0.16