Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W9YJS1

Protein Details
Accession W9YJS1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-72IPLPYKTQGKSKNKSKNKGKNRGKNLTKNKGKNKNKRKGRNKTNKAKTKNKTNSKTHydrophilic
NLS Segment(s)
PositionSequence
25-71GKSKNKSKNKGKNRGKNLTKNKGKNKNKRKGRNKTNKAKTKNKTNSK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MEPSPSTSSSRGGQIPIPLPYKTQGKSKNKSKNKGKNRGKNLTKNKGKNKNKRKGRNKTNKAKTKNKTNSKTNSKINSKINSKTNSKINSKTNSKTNSKTNSKTNSKTNSKSRSSSLQGTLHQNRQRQKNTMLKKAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.33
4 0.34
5 0.29
6 0.29
7 0.32
8 0.36
9 0.33
10 0.38
11 0.43
12 0.5
13 0.59
14 0.68
15 0.74
16 0.78
17 0.86
18 0.88
19 0.88
20 0.89
21 0.91
22 0.92
23 0.91
24 0.91
25 0.91
26 0.89
27 0.89
28 0.88
29 0.88
30 0.87
31 0.86
32 0.86
33 0.87
34 0.88
35 0.88
36 0.89
37 0.89
38 0.9
39 0.91
40 0.92
41 0.92
42 0.93
43 0.93
44 0.92
45 0.93
46 0.93
47 0.91
48 0.89
49 0.88
50 0.84
51 0.83
52 0.83
53 0.82
54 0.79
55 0.78
56 0.78
57 0.77
58 0.78
59 0.73
60 0.72
61 0.66
62 0.65
63 0.64
64 0.62
65 0.57
66 0.56
67 0.56
68 0.53
69 0.51
70 0.5
71 0.5
72 0.49
73 0.5
74 0.5
75 0.5
76 0.53
77 0.56
78 0.56
79 0.57
80 0.57
81 0.58
82 0.57
83 0.58
84 0.59
85 0.61
86 0.62
87 0.62
88 0.65
89 0.67
90 0.67
91 0.67
92 0.67
93 0.67
94 0.71
95 0.72
96 0.71
97 0.69
98 0.67
99 0.63
100 0.62
101 0.59
102 0.57
103 0.53
104 0.5
105 0.49
106 0.55
107 0.57
108 0.59
109 0.59
110 0.59
111 0.61
112 0.66
113 0.69
114 0.66
115 0.68
116 0.69
117 0.73