Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3K810

Protein Details
Accession J3K810    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-21VKIARNKRPKSLSHGRPPTIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 7, pero 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021867  Bmt2/SAMTOR  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0016433  F:rRNA (adenine) methyltransferase activity  
KEGG cim:CIMG_06371  -  
Pfam View protein in Pfam  
PF11968  Bmt2  
Amino Acid Sequences MVKIARNKRPKSLSHGRPPTIQKPIASLSARATRTLIRSHHQLHKKRARALTDGNEQEVHELDKKIEALGGLKSYQLASKTGQSKERGGDSSKVLIEWLKPALDGLTNCETRLRLLEVGALSARNTCSAVSCIDVVRIDLHSQEPGILEQDFMERPIPSTDPDKFHIISLSLVLNYVPDATTRGDMLRHTTAFLTSTLPTSNGSLRKLAPCLFLVLPAACVLNSRYFTEERLQDIMSSLGYSIIRRKLTQKLIYQLWKYNRPANPKSGGFEKKMVNPGAKRNNFTVILTPAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.74
4 0.75
5 0.77
6 0.75
7 0.73
8 0.67
9 0.56
10 0.51
11 0.51
12 0.5
13 0.44
14 0.38
15 0.34
16 0.39
17 0.39
18 0.35
19 0.34
20 0.3
21 0.32
22 0.36
23 0.34
24 0.31
25 0.38
26 0.44
27 0.52
28 0.58
29 0.63
30 0.68
31 0.74
32 0.77
33 0.78
34 0.77
35 0.72
36 0.69
37 0.68
38 0.65
39 0.64
40 0.58
41 0.52
42 0.46
43 0.41
44 0.35
45 0.28
46 0.23
47 0.18
48 0.16
49 0.15
50 0.16
51 0.16
52 0.15
53 0.15
54 0.13
55 0.11
56 0.11
57 0.13
58 0.11
59 0.11
60 0.11
61 0.11
62 0.12
63 0.12
64 0.12
65 0.12
66 0.19
67 0.25
68 0.28
69 0.33
70 0.34
71 0.36
72 0.37
73 0.4
74 0.35
75 0.33
76 0.32
77 0.29
78 0.29
79 0.26
80 0.23
81 0.2
82 0.18
83 0.16
84 0.15
85 0.13
86 0.1
87 0.09
88 0.09
89 0.1
90 0.11
91 0.1
92 0.13
93 0.17
94 0.17
95 0.18
96 0.19
97 0.18
98 0.16
99 0.18
100 0.16
101 0.11
102 0.1
103 0.13
104 0.12
105 0.12
106 0.12
107 0.1
108 0.08
109 0.09
110 0.09
111 0.07
112 0.07
113 0.06
114 0.07
115 0.08
116 0.08
117 0.08
118 0.09
119 0.08
120 0.09
121 0.09
122 0.08
123 0.08
124 0.08
125 0.07
126 0.07
127 0.08
128 0.07
129 0.07
130 0.07
131 0.06
132 0.06
133 0.07
134 0.06
135 0.06
136 0.06
137 0.07
138 0.07
139 0.07
140 0.08
141 0.07
142 0.08
143 0.09
144 0.1
145 0.1
146 0.14
147 0.16
148 0.18
149 0.21
150 0.23
151 0.22
152 0.22
153 0.21
154 0.18
155 0.15
156 0.13
157 0.11
158 0.08
159 0.07
160 0.07
161 0.06
162 0.05
163 0.05
164 0.04
165 0.04
166 0.06
167 0.07
168 0.07
169 0.08
170 0.08
171 0.09
172 0.1
173 0.14
174 0.16
175 0.15
176 0.16
177 0.15
178 0.15
179 0.15
180 0.16
181 0.13
182 0.1
183 0.11
184 0.11
185 0.11
186 0.11
187 0.12
188 0.16
189 0.17
190 0.18
191 0.2
192 0.21
193 0.23
194 0.26
195 0.26
196 0.23
197 0.2
198 0.23
199 0.2
200 0.19
201 0.18
202 0.15
203 0.14
204 0.12
205 0.12
206 0.07
207 0.08
208 0.09
209 0.12
210 0.14
211 0.15
212 0.18
213 0.18
214 0.21
215 0.26
216 0.27
217 0.26
218 0.27
219 0.26
220 0.22
221 0.23
222 0.21
223 0.15
224 0.12
225 0.09
226 0.09
227 0.09
228 0.1
229 0.15
230 0.21
231 0.23
232 0.25
233 0.3
234 0.36
235 0.45
236 0.51
237 0.52
238 0.54
239 0.59
240 0.65
241 0.65
242 0.64
243 0.63
244 0.63
245 0.61
246 0.62
247 0.6
248 0.62
249 0.63
250 0.62
251 0.62
252 0.57
253 0.57
254 0.58
255 0.58
256 0.53
257 0.54
258 0.51
259 0.5
260 0.55
261 0.54
262 0.52
263 0.52
264 0.58
265 0.63
266 0.64
267 0.61
268 0.57
269 0.6
270 0.54
271 0.5
272 0.46